To assess the data, attitudes, and beliefs of international college students towards using medical hashish (MC) for ache administration. This research makes use of information collected from 549 international college students from India (n = 289) and Middle Eastern nations largely from Egypt, Iran, Syria, and Jordan (n = 260) finding out drugs in Russia and Belarus. Data collected from Russian and Belarusian origin medical college students (n = 796) had been used for comparability functions.
Pearson’s chi-squared and t-test had been used to investigate the information. Attributes of potential jobs had been developed by the literature evaluate, semi-structured interviews, and a pilot survey. Forty selection units had been developed utilizing a fractional factorial design. A blended logit mannequin was used to estimate the relative power of the attributes. Willingness to pay and uptake charges for an outlined job had been additionally calculated primarily based on the blended logit estimates.
The closing pattern comprised 787 medical and nursing college students. The statistically important outcomes indicated “Bianzhi” (the variety of personnel allotted to every employer by the federal government) and bodily conflicts between docs and sufferers had been two of crucial non-monetary job traits that incentivized each medical and nursing college students. Policy simulation urged that respondents had been most delicate to a wage enhance, and the impact of incentive packages was stronger for college students with a rural household background.
Foreign college students’ nation of origin and gender statuses don’t are usually correlated with medical pupil responses towards medical hashish use. Students from Russia and Belarus who recognized as secular, in comparison with those that had been non secular, reported extra optimistic attitudes towards medical hashish and coverage change. This research is the primary to look at the attitudes, data, and beliefs towards medical hashish amongst international college students from India and Middle Eastern nations finding out in Russia and Belarus, two nations who oppose its leisure and drugs use.
Indian and Middle Eastern college students, as a gaggle, are usually extra supportive of MC than their Russian and Belarusian counterparts. These outcomes could also be linked to cultural and historic causes. This research supplies helpful info for attainable medical and allied well being curriculum and training functions. When evaluating Study 1 and 2, there was larger stigma discount in the service consumer video arm with solely melancholy versus service consumer movies describing melancholy and psychosis.
Impact of Service User Video Presentations on Explicit and Implicit Stigma towards Mental Illness amongst Medical Students in Nepal: A Randomized Controlled Trial
This research evaluated the influence of didactic movies and service consumer testimonial movies on psychological sickness stigma amongst medical college students. Two randomized managed trials had been performed in Nepal. Study 1 examined stigma discount for melancholy. Study 2 examined melancholy and psychosis. Participants had been Nepali medical college students (Study 1: n = 94, Study 2: n = 213) randomized to a few situations: a didactic video primarily based on the psychological well being Gap Action Programme (mhGAP), a service consumer video about residing with psychological sickness, or a management situation with no movies. In Study 1, movies solely addressed melancholy.
In Study 2, movies addressed melancholy and psychosis. In Study 1, each didactic and service consumer movies diminished stigma in comparison with the management. In Study 2 (melancholy and psychosis), there have been no variations among the many three arms. In abstract, didactic and service consumer movies had been related to decreased stigma when content material addressed solely melancholy. However, no stigma discount was seen when together with melancholy and psychosis. This calls for contemplating totally different methods to handle stigma primarily based on kinds of psychological sicknesses
Specific mindfulness traits shield towards destructive results of trait anxiousness on medical pupil wellbeing throughout high-pressure durations
Medical training is very demanding and proof exhibits that medical college students are thrice extra vulnerable to deteriorating bodily and psychological well being than the common school pupil. While trait anxiousness might additional enhance such danger, little is thought about the position of trait mindfulness in mitigating these results. Here we look at the protecting position of particular mindfulness aspects as mediators in pathways from trait anxiousness to perceived stress, psychosomatic burden and sleep-wake high quality in medical college students, throughout repeated measurements all through the primary trimester of the varsity 12 months.
Specific aspects of Nonjudging of interior expertise and Acting with consciousness proved to be the simplest mediators. Findings spotlight that the useful position of mindfulness aspects in mitigating destructive penalties of trait anxiousness on medical pupil wellbeing is revealed in high-pressure durations and when self-regulation is required probably the most.
Preclinical medical college students enrolled in the second 12 months of the Medical School of University of Bologna accomplished self-report questionnaires inspecting character traits in addition to bodily and psychological wellbeing. Data had been collected in the beginning (Time 1: N = 349) and the top of the primary trimester (Time 2: N = 305). As college students approached the top of the trimester and upcoming exams, reported ranges of perceived stress, psychosomatic issues and difficulties in wakefulness elevated considerably in comparison with the start of the trimester.
, 10MG) Donkey Anti-Sheep IgG (H&L), 10MG |
|
A010-10MG |
Arbor Assays |
10MG |
EUR 268 |
 Anti-Inflammatory Peptide 1 |
|
A1008-10 |
ApexBio |
10 mg |
EUR 166 |
|
Description: Anti-Inflammatory Peptide 1 (C45H82N12O14S2), with the sequence H-Met-Gln-Met-Lys-Lys-Val-Leu-Asp-Ser-OH, belongs to the group of synthetic oligopeptides corresponding to a region of high amino-acid sequence similarity between uteroglobin and lipocortin I |
Anti-Inflammatory Peptide 1 |
|
A1008-25 |
ApexBio |
25 mg |
EUR 212 |
|
Description: Anti-Inflammatory Peptide 1 (C45H82N12O14S2), with the sequence H-Met-Gln-Met-Lys-Lys-Val-Leu-Asp-Ser-OH, belongs to the group of synthetic oligopeptides corresponding to a region of high amino-acid sequence similarity between uteroglobin and lipocortin I |
Anti-Inflammatory Peptide 1 |
|
A1008-5 |
ApexBio |
5 mg |
EUR 119 |
|
Description: Anti-Inflammatory Peptide 1 (C45H82N12O14S2), with the sequence H-Met-Gln-Met-Lys-Lys-Val-Leu-Asp-Ser-OH, belongs to the group of synthetic oligopeptides corresponding to a region of high amino-acid sequence similarity between uteroglobin and lipocortin I |
Anti-Inflammatory Peptide 1 |
|
5-00709 |
CHI Scientific |
4 x 5mg |
Ask for price |
Anti-Inflammatory Peptide 1 |
|
20-abx266089 |
Abbexa |
-
EUR 411.00
-
EUR 662.00
-
EUR 314.00
|
|
- Shipped within 5-10 working days.
|
Anti-Inflammatory Peptide 1 |
|
H-9435.0005 |
Bachem |
5.0mg |
EUR 273 |
|
Description: Sum Formula: C45H82N12O14S2; CAS# [118850-71-8] |
Anti-Inflammatory Peptide 1 |
|
H-9435.0025 |
Bachem |
25.0mg |
EUR 998 |
|
Description: Sum Formula: C45H82N12O14S2; CAS# [118850-71-8] |
 Recombinant other protein 1, Untagged, E.coli-10mg |
|
QP13162-10mg |
EnQuireBio |
10mg |
EUR 201 |
Recombinant other protein 1, Untagged, E.coli-10mg |
|
QP10853-EC-10mg |
EnQuireBio |
10mg |
EUR 155 |
 Recombinant other Alarelin Protein, Untagged, -10mg |
|
QP10997-10mg |
EnQuireBio |
10mg |
EUR 201 |
 Anti-Inflammatory Peptide 2 |
|
5-00710 |
CHI Scientific |
4 x 5mg |
Ask for price |
 Anti-Inflammatory Peptide 3 |
|
5-00711 |
CHI Scientific |
4 x 5mg |
Ask for price |
Anti-Inflammatory Peptide 3 |
|
20-abx266075 |
Abbexa |
-
EUR 411.00
-
EUR 662.00
-
EUR 314.00
|
|
- Shipped within 5-10 working days.
|
Anti-Inflammatory Peptide 2 |
|
20-abx266098 |
Abbexa |
-
EUR 411.00
-
EUR 662.00
-
EUR 314.00
|
|
- Shipped within 5-10 working days.
|
Anti-Inflammatory Peptide 2 |
|
H-9440.0005 |
Bachem |
5.0mg |
EUR 273 |
|
Description: Sum Formula: C46H77N13O15S; CAS# [118850-72-9] |
Anti-Inflammatory Peptide 2 |
|
H-9440.0025 |
Bachem |
25.0mg |
EUR 998 |
|
Description: Sum Formula: C46H77N13O15S; CAS# [118850-72-9] |
 Recombinant Human GH1/ Growth hormone 1 Protein, Untagged, E.coli-10mg |
|
QP5354-10mg |
EnQuireBio |
10mg |
EUR 1243 |
 Recombinant Human EDN3 Protein, Untagged, E.coli-10mg |
|
QP11747-10mg |
EnQuireBio |
10mg |
EUR 2349 |
 Recombinant other Exenatide Protein, Untagged, E.coli-10mg |
|
QP11816-10mg |
EnQuireBio |
10mg |
EUR 962 |
 Recombinant E.coli LACTB Protein, Untagged, E.coli-10mg |
|
QP12522-10mg |
EnQuireBio |
10mg |
EUR 962 |
 Recombinant other Lanreotide Protein, Untagged, E.coli-10mg |
|
QP12536-10mg |
EnQuireBio |
10mg |
EUR 563 |
 Recombinant Human LHRH Protein, Untagged, E.coli-10mg |
|
QP12569-10mg |
EnQuireBio |
10mg |
EUR 155 |
 Recombinant Human Leptin Protein, Untagged, E.coli-10mg |
|
QP5350-10mg |
EnQuireBio |
10mg |
EUR 509 |
 Recombinant Mouse Leptin Protein, Untagged, E.coli-10mg |
|
QP5429-10mg |
EnQuireBio |
10mg |
EUR 962 |
 Recombinant Rat Leptin Protein, Untagged, E.coli-10mg |
|
QP5507-10mg |
EnQuireBio |
10mg |
EUR 916 |
 Recombinant Human Insulin Protein, Untagged, E.coli-10mg |
|
QP10732-10mg |
EnQuireBio |
10mg |
EUR 201 |
 Recombinant other Lysostaphin Protein, Untagged, E.coli-10mg |
|
QP10778-10mg |
EnQuireBio |
10mg |
EUR 418 |
 Recombinant Multi Species ACTH Protein, Untagged, -10mg |
|
QP10950-10mg |
EnQuireBio |
10mg |
EUR 201 |
 Recombinant other Atosiban Protein, Untagged, E.coli-10mg |
|
QP11102-10mg |
EnQuireBio |
10mg |
EUR 155 |
 Recombinant other Cetrorelix Protein, Untagged, E.coli-10mg |
|
QP11394-10mg |
EnQuireBio |
10mg |
EUR 862 |
 Recombinant other SPA Protein, His, E.coli-10mg |
|
QP13566-10mg |
EnQuireBio |
10mg |
EUR 155 |
 Recombinant other SST Protein, Untagged, E.coli-10mg |
|
QP13598-10mg |
EnQuireBio |
10mg |
EUR 201 |
 Recombinant Rabbit TNC Protein, Untagged, Rabbit-10mg |
|
QP13765-10mg |
EnQuireBio |
10mg |
EUR 1061 |
 Recombinant other Avidin Biotin Protein, Untagged, -10mg |
|
QP10526-10mg |
EnQuireBio |
10mg |
EUR 201 |
 Recombinant Human CTRB1 Protein, Untagged, E.coli-10mg |
|
QP10565-10mg |
EnQuireBio |
10mg |
EUR 201 |
 Polyclonal Goat anti-GST α-form |
|
GST-ANTI-1 |
Detroit R&D |
50 uL |
EUR 280 |
 Recombinant Human Ferritin Protein, Untagged, Native Protein-10mg |
|
QP11867-10mg |
EnQuireBio |
10mg |
EUR 2158 |
 Recombinant Bovine Fibronectin Protein, Untagged, Native Protein-10mg |
|
QP11880-10mg |
EnQuireBio |
10mg |
EUR 1017 |
 Recombinant Human Fibronectin Protein, Untagged, Native Protein-10mg |
|
QP11881-10mg |
EnQuireBio |
10mg |
EUR 1017 |
 Recombinant Human Haptoglobin Protein, Untagged, Native Protein-10mg |
|
QP12103-10mg |
EnQuireBio |
10mg |
EUR 1959 |
 Recombinant Human HbA1c Protein, Untagged, Native Protein-10mg |
|
QP12117-10mg |
EnQuireBio |
10mg |
EUR 2259 |
 Recombinant Human HDL Protein, Untagged, Native Protein-10mg |
|
QP12211-10mg |
EnQuireBio |
10mg |
EUR 201 |
 Recombinant other HSA Protein, Untagged, Pichia Pastoris-10mg |
|
QP12314-10mg |
EnQuireBio |
10mg |
EUR 155 |
 Recombinant other HSA Recombinant Protein, Untagged, Rice-10mg |
|
QP12317-10mg |
EnQuireBio |
10mg |
EUR 163 |
 Recombinant Human LDL Protein, Untagged, Native Protein-10mg |
|
QP12550-10mg |
EnQuireBio |
10mg |
EUR 163 |
 Recombinant Human LTF Protein, Untagged, Native Protein-10mg |
|
QP12595-10mg |
EnQuireBio |
10mg |
EUR 4851 |
 Recombinant Human LTF Holo Protein, Untagged, Rice-10mg |
|
QP12596-10mg |
EnQuireBio |
10mg |
EUR 155 |
 Recombinant Human Myoglobin Protein, Untagged, Native Protein-10mg |
|
QP12776-10mg |
EnQuireBio |
10mg |
EUR 2059 |
 Recombinant other Protein-L Protein, Untagged, E.coli-10mg |
|
QP13168-10mg |
EnQuireBio |
10mg |
EUR 201 |
 Recombinant other Lipase A Protein, Untagged, E.coli-10mg |
|
QP10772-10mg |
EnQuireBio |
10mg |
EUR 155 |
 Recombinant Human MG Protein, Untagged, Native Protein-10mg |
|
QP10785-10mg |
EnQuireBio |
10mg |
EUR 490 |
 Recombinant Bovine Trypsin Protein, Untagged, Native Protein-10mg |
|
QP10896-10mg |
EnQuireBio |
10mg |
EUR 201 |
 Recombinant Human UTI Protein, Untagged, Native Protein-10mg |
|
QP10909-10mg |
EnQuireBio |
10mg |
EUR 209 |
 Recombinant Human A2M Protein, Untagged, Native Protein-10mg |
|
QP10922-10mg |
EnQuireBio |
10mg |
EUR 1624 |
 Recombinant Human APOB Protein, Untagged, Native Protein-10mg |
|
QP11047-10mg |
EnQuireBio |
10mg |
EUR 4553 |
 Recombinant Human B2M Protein, Untagged, Native Protein-10mg |
|
QP11117-10mg |
EnQuireBio |
10mg |
EUR 1415 |
 Recombinant Human C1q Protein, Untagged, Native Protein-10mg |
|
QP11228-10mg |
EnQuireBio |
10mg |
EUR 4553 |
 Recombinant Human C3c Protein, Untagged, Native Protein-10mg |
|
QP11238-10mg |
EnQuireBio |
10mg |
EUR 1161 |
 Recombinant Human C4c Protein, Untagged, Native Protein-10mg |
|
QP11240-10mg |
EnQuireBio |
10mg |
EUR 3556 |
 Recombinant Human CKM Protein, Untagged, Native Protein-10mg |
|
QP11436-10mg |
EnQuireBio |
10mg |
EUR 4806 |
 Recombinant Human CRP Protein, Untagged, Native Protein-10mg |
|
QP11511-10mg |
EnQuireBio |
10mg |
EUR 916 |
 Recombinant other SPA 33.4kDa Protein, Untagged, E.coli-10mg |
|
QP13567-10mg |
EnQuireBio |
10mg |
EUR 155 |
 Recombinant other SPA Long Protein, Untagged, E.coli-10mg |
|
QP13568-10mg |
EnQuireBio |
10mg |
EUR 155 |
 Recombinant other SPA-Cys Protein, Untagged, E.coli-10mg |
|
QP13569-10mg |
EnQuireBio |
10mg |
EUR 155 |
 Recombinant other Streptavidin Protein, Untagged, Native Protein-10mg |
|
QP13625-10mg |
EnQuireBio |
10mg |
EUR 201 |
 Recombinant Multi Species Trp Protein, Untagged, E.coli-10mg |
|
QP13821-10mg |
EnQuireBio |
10mg |
EUR 245 |
 Recombinant other hCG Protein, Untagged, Native Protein-10mg |
|
QP10664-10mg |
EnQuireBio |
10mg |
EUR 245 |
 Recombinant other HSA Lipid free Protein, Untagged, Rice-10mg |
|
QP12316-10mg |
EnQuireBio |
10mg |
EUR 163 |
 Recombinant other Protein-A/G Protein, His, E.coli-10mg |
|
QP13163-10mg |
EnQuireBio |
10mg |
EUR 201 |
 Recombinant other Protein-G His Protein, His, E.coli-10mg |
|
QP13167-10mg |
EnQuireBio |
10mg |
EUR 318 |
 Recombinant other Protein-L Cys Protein, Untagged, E.coli-10mg |
|
QP13169-10mg |
EnQuireBio |
10mg |
EUR 201 |
 Recombinant Human Collagen-III Protein, Untagged, Pichia Pastoris-10mg |
|
QP11479-10mg |
EnQuireBio |
10mg |
EUR 281 |
 Recombinant other Cys-Protein-G Protein, Untagged, E.coli-10mg |
|
QP11587-10mg |
EnQuireBio |
10mg |
EUR 318 |
 Recombinant other Cys-Protein-L Protein, Untagged, E.coli-10mg |
|
QP11588-10mg |
EnQuireBio |
10mg |
EUR 201 |
 Recombinant other SPA-Cys His Protein, His, E.coli-10mg |
|
QP13570-10mg |
EnQuireBio |
10mg |
EUR 155 |
 Recombinant other SPA-Cys Long Protein, Untagged, E.coli-10mg |
|
QP13571-10mg |
EnQuireBio |
10mg |
EUR 155 |
 Recombinant other Protein Cys-A/G Protein, Untagged, E.coli-10mg |
|
QP13161-10mg |
EnQuireBio |
10mg |
EUR 201 |
 Recombinant other Protein-A/G Cys Protein, Untagged, E.coli-10mg |
|
QP13164-10mg |
EnQuireBio |
10mg |
EUR 201 |
 Recombinant other Protein-A/G/L Protein, Untagged, E.coli-10mg |
|
QP13165-10mg |
EnQuireBio |
10mg |
EUR 327 |
 Recombinant other Protein-A/G/L-Cys Protein, Untagged, E.coli-10mg |
|
QP13166-10mg |
EnQuireBio |
10mg |
EUR 327 |
 Recombinant other Cys-Protein-A/G/L Protein, Untagged, E.coli-10mg |
|
QP11586-10mg |
EnQuireBio |
10mg |
EUR 327 |
 Rabbit Polyclonal antibody Anti-CRBN |
|
Anti-CRBN |
ImmunoStep |
50 µg |
EUR 349 |
 Anti-Macrophage Inflammatory Protein 3 beta/Ccl19 Antibody |
|
A01605-1 |
BosterBio |
100ug/vial |
EUR 294 |
 anti-Macrophage Inflammatory Protein 1 |
|
YF-PA14542 |
Abfrontier |
50 ug |
EUR 363 |
|
Description: Mouse polyclonal to Macrophage Inflammatory Protein 1 |
anti-Macrophage Inflammatory Protein 1 |
|
YF-PA24668 |
Abfrontier |
50 ul |
EUR 334 |
|
Description: Mouse polyclonal to Macrophage Inflammatory Protein 1 |
 Anti-Peptide YY/PYY Antibody |
|
A04223-1 |
BosterBio |
100ug/vial |
EUR 334 |
) Anti-Macrophage Inflammatory Protein 1 (4E7) |
|
YF-MA10821 |
Abfrontier |
100 ug |
EUR 363 |
|
Description: Mouse monoclonal to Macrophage Inflammatory Protein 1 |
 anti-Macrophage Inflammatory Protein 1 beta |
|
YF-PA14543 |
Abfrontier |
100 ug |
EUR 403 |
|
Description: Rabbit polyclonal to Macrophage Inflammatory Protein 1 beta |
anti-Macrophage Inflammatory Protein 1 beta |
|
YF-PA24669 |
Abfrontier |
50 ul |
EUR 334 |
|
Description: Mouse polyclonal to Macrophage Inflammatory Protein 1 beta |
) Biotin-DHPE: (10mg) |
|
60022 |
Biotium |
10MG |
EUR 237 |
|
Description: Minimum order quantity: 1 unit of 10MG |
 Cellmaxin, 10mg/ml |
|
C3314-006 |
GenDepot |
6x1ml |
EUR 212 |
Cellmaxin, 10mg/ml |
|
C3314-020 |
GenDepot |
20ml |
EUR 327 |
 Polyclonal Goat anti-GST μ-form |
|
GST-ANTI-2 |
Detroit R&D |
50 uL |
EUR 280 |
 Polyclonal Goat anti-GST p-form |
|
GST-ANTI-3 |
Detroit R&D |
50 uL |
EUR 280 |
) MIP-1a Macrophage Inflammatory Protein-1 Alpha Mouse Recombinant Protein (CCL3) |
|
PROTP10855-1 |
BosterBio |
Regular: 10ug |
EUR 317 |
|
Description: Macrophage Inflammatory Protein-1 alpha Mouse Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 69 amino acids and having a molecular mass of 7820 Dalton. ;The MIP-1a is purified by proprietary chromatographic techniques. |
 HIV-1 Tat Protein Peptide |
|
B1433-1 |
ApexBio |
1 mg |
EUR 128 |
|
Description: HIV-1 Tat Protein Peptide |
 (human)) Amyloid ?-Peptide (1-42) (human) |
|
B6057-.1 |
ApexBio |
100 ug |
EUR 276 |
: (10mg)) Hydroxystilbamidine (Fluoro-Gold): (10mg) |
|
80014 |
Biotium |
10MG |
EUR 253 |
|
Description: Minimum order quantity: 1 unit of 10MG |
 Transferrin Solution, 10mg/ml |
|
CA205-005 |
GenDepot |
5x1ml |
EUR 115 |
, His Tag) MIP-1a Macrophage Inflammatory Protein-1 Alpha Human Recombinant Protein (CCL3), His Tag |
|
PROTP10147-1 |
BosterBio |
Regular: 10ug |
EUR 317 |
|
Description: Macrophage Inflammatory Protein-1 alpha His Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 68 amino acids and having a molecular mass of 7820 Dalton with an amino-terminal hexahistidine tag. ;The MIP-1a-His is purified by proprietary chromatographic techniques. |
 anti-Macrophage inflammatory protein 5 |
|
YF-PA20144 |
Abfrontier |
50 ug |
EUR 363 |
|
Description: Mouse polyclonal to Macrophage inflammatory protein 5 |
anti-Macrophage inflammatory protein 5 |
|
YF-PA20145 |
Abfrontier |
100 ul |
EUR 403 |
|
Description: Rabbit polyclonal to Macrophage inflammatory protein 5 |
anti-Macrophage inflammatory protein 5 |
|
YF-PA20146 |
Abfrontier |
100 ug |
EUR 403 |
|
Description: Rabbit polyclonal to Macrophage inflammatory protein 5 |
anti-Macrophage inflammatory protein 5 |
|
YF-PA14551 |
Abfrontier |
100 ul |
EUR 403 |
|
Description: Rabbit polyclonal to Macrophage inflammatory protein 5 |
anti-Macrophage inflammatory protein 5 |
|
YF-PA14552 |
Abfrontier |
100 ug |
EUR 403 |
|
Description: Rabbit polyclonal to Macrophage inflammatory protein 5 |
 anti-Macrophage Inflammatory Protein 4 |
|
YF-PA14553 |
Abfrontier |
100 ul |
EUR 403 |
|
Description: Rabbit polyclonal to Macrophage Inflammatory Protein 4 |
anti-Macrophage Inflammatory Protein 4 |
|
YF-PA14554 |
Abfrontier |
100 ug |
EUR 403 |
|
Description: Rabbit polyclonal to Macrophage Inflammatory Protein 4 |
 anti-Macrophage Inflammatory Protein 3 |
|
YF-PA14559 |
Abfrontier |
50 ug |
EUR 363 |
|
Description: Mouse polyclonal to Macrophage Inflammatory Protein 3 |
anti-Macrophage Inflammatory Protein 3 |
|
YF-PA14560 |
Abfrontier |
100 ul |
EUR 403 |
|
Description: Rabbit polyclonal to Macrophage Inflammatory Protein 3 |
anti-Macrophage Inflammatory Protein 3 |
|
YF-PA14561 |
Abfrontier |
100 ug |
EUR 403 |
|
Description: Rabbit polyclonal to Macrophage Inflammatory Protein 3 |
anti-Macrophage inflammatory protein 5 |
|
YF-PA24672 |
Abfrontier |
50 ul |
EUR 334 |
|
Description: Mouse polyclonal to Macrophage inflammatory protein 5 |
anti-Macrophage Inflammatory Protein 4 |
|
YF-PA24674 |
Abfrontier |
50 ul |
EUR 334 |
|
Description: Mouse polyclonal to Macrophage Inflammatory Protein 4 |
 (human)) Amyloid Beta-Peptide (1-40) (human) |
|
A1124-1 |
ApexBio |
1 mg |
EUR 189 |
|
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein. |
) YAP-TEAD Inhibitor 1 (Peptide 17) |
|
A1149-1 |
ApexBio |
1 mg |
EUR 235 |
 (human)) Brain natriuretic peptide (1-32) (human) |
|
B5442-1 |
ApexBio |
1 mg |
EUR 518 |
 Anti-Macrophage Inflammatory Protein 1 beta/CCL4 Antibody |
|
PA1379 |
BosterBio |
100ug/vial |
EUR 294 |
 Anti-CCL3/Macrophage Inflammatory Protein 1 alpha Antibody |
|
PB9022 |
BosterBio |
100ug/vial |
EUR 294 |
Anti-Macrophage Inflammatory Protein 1 beta/CCL4 Antibody |
|
PB9064 |
BosterBio |
100ug/vial |
EUR 294 |
Anti-CCL3/Macrophage Inflammatory Protein 1 alpha Antibody |
|
PB9571 |
BosterBio |
100ug/vial |
EUR 294 |
 Anti-Macrophage Inflammatory Protein 1 beta?/CCL4 Antibody |
|
PB9572 |
BosterBio |
100ug/vial |
EUR 294 |
, rabbit) Cathelicidin Anti-microbial peptide (CAP-18), rabbit |
|
SP-88322-1 |
Alpha Diagnostics |
1 mg |
EUR 347 |
 3, 6-dioxaoctane-1, 8-diyl dimethanethiosulfonate:10mg |
|
91042 |
Biotium |
10MG |
EUR 151 |
|
Description: Minimum order quantity: 1 unit of 10MG |
 (1-13), human) GnRH Associated Peptide (GAP) (1-13), human |
|
A1020-1 |
ApexBio |
1 mg |
EUR 90 |
|
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP). |
) Dihydrorhodamine 123, dihydrochloride salt: (10mg) |
|
10056 |
Biotium |
10MG |
EUR 191 |
|
Description: Minimum order quantity: 1 unit of 10MG |
 DAPI, 10mg/mL in H2O |
|
40043 |
Biotium |
1ML |
EUR 134 |
|
Description: Minimum order quantity: 1 unit of 1ML |
) RNase A Solution (10mg/ml) |
|
RB0474 |
Bio Basic |
1ml |
EUR 55.22 |
- Product category: Proteins/Enzymes/Endonucleases
|
 Anti-Periphilin 1 Antibody |
|
A06996-1 |
BosterBio |
100ul |
EUR 397 |
|
Description: Rabbit Polyclonal Antibody for Periphilin 1 Antibody (PPHLN1) detection.tested for WB in Human, Mouse. |
 Anti-Lyl-1 Antibody |
|
A07491-1 |
BosterBio |
100ul |
EUR 397 |
|
Description: Rabbit Polyclonal Lyl-1 Antibody. Validated in IHC and tested in Human, Mouse, Rat. |
 Anti-GLI-1 Antibody |
|
A07972-1 |
BosterBio |
100ul |
EUR 397 |
|
Description: Rabbit Polyclonal Antibody for GLI-1 Antibody (ACSS1) detection. Tested with WB in Human, Mouse, Rat. |
 Anti-Cerebellin 1 Antibody |
|
A09176-1 |
BosterBio |
100ul |
EUR 397 |
|
Description: Rabbit Polyclonal Antibody for Cerebellin 1 Antibody (CBLN1) detection. Tested with WB in Human, Mouse, Rat. |
Mediation outcomes confirmed that trait anxiousness predicted such outcomes whereas the protecting position of mindfulness aspects in mitigating these results was important solely at Time 2. Cultivating consciousness and nonjudgmental acceptance of 1’s interior experiences is an important self-regulation useful resource that may assist medical college students maintain their wellbeing as they be taught and all through their high-pressure training and skilled careers.
