Foreign Medical Students in Eastern Europe: Knowledge, Attitudes and Beliefs about Medical Cannabis for Pain Management

To assess the data, attitudes, and beliefs of international college students towards using medical hashish (MC) for ache administration. This research makes use of information collected from 549 international college students from India (n = 289) and Middle Eastern nations largely from Egypt, Iran, Syria, and Jordan (n = 260) finding out drugs in Russia and Belarus. Data collected from Russian and Belarusian origin medical college students (n = 796) had been used for comparability functions.

Pearson’s chi-squared and t-test had been used to investigate the information. Attributes of potential jobs had been developed by the literature evaluate, semi-structured interviews, and a pilot survey. Forty selection units had been developed utilizing a fractional factorial design. A blended logit mannequin was used to estimate the relative power of the attributes. Willingness to pay and uptake charges for an outlined job had been additionally calculated primarily based on the blended logit estimates.

The closing pattern comprised 787 medical and nursing college students. The statistically important outcomes indicated “Bianzhi” (the variety of personnel allotted to every employer by the federal government) and bodily conflicts between docs and sufferers had been two of crucial non-monetary job traits that incentivized each medical and nursing college students. Policy simulation urged that respondents had been most delicate to a wage enhance, and the impact of incentive packages was stronger for college students with a rural household background.

Foreign college students’ nation of origin and gender statuses don’t are usually correlated with medical pupil responses towards medical hashish use. Students from Russia and Belarus who recognized as secular, in comparison with those that had been non secular, reported extra optimistic attitudes towards medical hashish and coverage change. This research is the primary to look at the attitudes, data, and beliefs towards medical hashish amongst international college students from India and Middle Eastern nations finding out in Russia and Belarus, two nations who oppose its leisure and drugs use.

Indian and Middle Eastern college students, as a gaggle, are usually extra supportive of MC than their Russian and Belarusian counterparts. These outcomes could also be linked to cultural and historic causes. This research supplies helpful info for attainable medical and allied well being curriculum and training functions. When evaluating Study 1 and 2, there was larger stigma discount in the service consumer video arm with solely melancholy versus service consumer movies describing melancholy and psychosis.

Impact of Service User Video Presentations on Explicit and Implicit Stigma towards Mental Illness amongst Medical Students in Nepal: A Randomized Controlled Trial

This research evaluated the influence of didactic movies and service consumer testimonial movies on psychological sickness stigma amongst medical college students. Two randomized managed trials had been performed in Nepal. Study 1 examined stigma discount for melancholy. Study 2 examined melancholy and psychosis. Participants had been Nepali medical college students (Study 1: n = 94, Study 2: n = 213) randomized to a few situations: a didactic video primarily based on the psychological well being Gap Action Programme (mhGAP), a service consumer video about residing with psychological sickness, or a management situation with no movies. In Study 1, movies solely addressed melancholy.

In Study 2, movies addressed melancholy and psychosis. In Study 1, each didactic and service consumer movies diminished stigma in comparison with the management. In Study 2 (melancholy and psychosis), there have been no variations among the many three arms. In abstract, didactic and service consumer movies had been related to decreased stigma when content material addressed solely melancholy. However, no stigma discount was seen when together with melancholy and psychosis. This calls for contemplating totally different methods to handle stigma primarily based on kinds of psychological sicknesses

Specific mindfulness traits shield towards destructive results of trait anxiousness on medical pupil wellbeing throughout high-pressure durations

Medical training is very demanding and proof exhibits that medical college students are thrice extra vulnerable to deteriorating bodily and psychological well being than the common school pupil. While trait anxiousness might additional enhance such danger, little is thought about the position of trait mindfulness in mitigating these results. Here we look at the protecting position of particular mindfulness aspects as mediators in pathways from trait anxiousness to perceived stress, psychosomatic burden and sleep-wake high quality in medical college students, throughout repeated measurements all through the primary trimester of the varsity 12 months.

Specific aspects of Nonjudging of interior expertise and Acting with consciousness proved to be the simplest mediators. Findings spotlight that the useful position of mindfulness aspects in mitigating destructive penalties of trait anxiousness on medical pupil wellbeing is revealed in high-pressure durations and when self-regulation is required probably the most.

Preclinical medical college students enrolled in the second 12 months of the Medical School of University of Bologna accomplished self-report questionnaires inspecting character traits in addition to bodily and psychological wellbeing. Data had been collected in the beginning (Time 1: N = 349) and the top of the primary trimester (Time 2: N = 305). As college students approached the top of the trimester and upcoming exams, reported ranges of perceived stress, psychosomatic issues and difficulties in wakefulness elevated considerably in comparison with the start of the trimester.

Donkey Anti-Sheep IgG (H&L), 10MG
A010-10MG	Arbor Assays	10MG	EUR 268

Anti-Inflammatory Peptide 1
A1008-10	ApexBio	10 mg	EUR 166
Description: Anti-Inflammatory Peptide 1 (C45H82N12O14S2), with the sequence H-Met-Gln-Met-Lys-Lys-Val-Leu-Asp-Ser-OH, belongs to the group of synthetic oligopeptides corresponding to a region of high amino-acid sequence similarity between uteroglobin and lipocortin I

Anti-Inflammatory Peptide 1
A1008-25	ApexBio	25 mg	EUR 212
Description: Anti-Inflammatory Peptide 1 (C45H82N12O14S2), with the sequence H-Met-Gln-Met-Lys-Lys-Val-Leu-Asp-Ser-OH, belongs to the group of synthetic oligopeptides corresponding to a region of high amino-acid sequence similarity between uteroglobin and lipocortin I

Anti-Inflammatory Peptide 1
A1008-5	ApexBio	5 mg	EUR 119
Description: Anti-Inflammatory Peptide 1 (C45H82N12O14S2), with the sequence H-Met-Gln-Met-Lys-Lys-Val-Leu-Asp-Ser-OH, belongs to the group of synthetic oligopeptides corresponding to a region of high amino-acid sequence similarity between uteroglobin and lipocortin I

Anti-Inflammatory Peptide 1
5-00709	CHI Scientific	4 x 5mg	Ask for price

Anti-Inflammatory Peptide 1
20-abx266089	Abbexa	EUR 411.00 EUR 662.00 EUR 314.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

Anti-Inflammatory Peptide 1
H-9435.0005	Bachem	5.0mg	EUR 273
Description: Sum Formula: C45H82N12O14S2; CAS# [118850-71-8]

Anti-Inflammatory Peptide 1
H-9435.0025	Bachem	25.0mg	EUR 998
Description: Sum Formula: C45H82N12O14S2; CAS# [118850-71-8]

Recombinant other protein 1, Untagged, E.coli-10mg
QP13162-10mg	EnQuireBio	10mg	EUR 201

Recombinant other protein 1, Untagged, E.coli-10mg
QP10853-EC-10mg	EnQuireBio	10mg	EUR 155

Recombinant other Alarelin Protein, Untagged, -10mg
QP10997-10mg	EnQuireBio	10mg	EUR 201

Anti-Inflammatory Peptide 2
5-00710	CHI Scientific	4 x 5mg	Ask for price

Anti-Inflammatory Peptide 3
5-00711	CHI Scientific	4 x 5mg	Ask for price

Anti-Inflammatory Peptide 3
20-abx266075	Abbexa	EUR 411.00 EUR 662.00 EUR 314.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

Anti-Inflammatory Peptide 2
20-abx266098	Abbexa	EUR 411.00 EUR 662.00 EUR 314.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

Anti-Inflammatory Peptide 2
H-9440.0005	Bachem	5.0mg	EUR 273
Description: Sum Formula: C46H77N13O15S; CAS# [118850-72-9]

Anti-Inflammatory Peptide 2
H-9440.0025	Bachem	25.0mg	EUR 998
Description: Sum Formula: C46H77N13O15S; CAS# [118850-72-9]

Recombinant Human GH1/ Growth hormone 1 Protein, Untagged, E.coli-10mg
QP5354-10mg	EnQuireBio	10mg	EUR 1243

Recombinant Human EDN3 Protein, Untagged, E.coli-10mg
QP11747-10mg	EnQuireBio	10mg	EUR 2349

Recombinant other Exenatide Protein, Untagged, E.coli-10mg
QP11816-10mg	EnQuireBio	10mg	EUR 962

Recombinant E.coli LACTB Protein, Untagged, E.coli-10mg
QP12522-10mg	EnQuireBio	10mg	EUR 962

Recombinant other Lanreotide Protein, Untagged, E.coli-10mg
QP12536-10mg	EnQuireBio	10mg	EUR 563

Recombinant Human LHRH Protein, Untagged, E.coli-10mg
QP12569-10mg	EnQuireBio	10mg	EUR 155

Recombinant Human Leptin Protein, Untagged, E.coli-10mg
QP5350-10mg	EnQuireBio	10mg	EUR 509

Recombinant Mouse Leptin Protein, Untagged, E.coli-10mg
QP5429-10mg	EnQuireBio	10mg	EUR 962

Recombinant Rat Leptin Protein, Untagged, E.coli-10mg
QP5507-10mg	EnQuireBio	10mg	EUR 916

Recombinant Human Insulin Protein, Untagged, E.coli-10mg
QP10732-10mg	EnQuireBio	10mg	EUR 201

Recombinant other Lysostaphin Protein, Untagged, E.coli-10mg
QP10778-10mg	EnQuireBio	10mg	EUR 418

Recombinant Multi Species ACTH Protein, Untagged, -10mg
QP10950-10mg	EnQuireBio	10mg	EUR 201

Recombinant other Atosiban Protein, Untagged, E.coli-10mg
QP11102-10mg	EnQuireBio	10mg	EUR 155

Recombinant other Cetrorelix Protein, Untagged, E.coli-10mg
QP11394-10mg	EnQuireBio	10mg	EUR 862

Recombinant other SPA Protein, His, E.coli-10mg
QP13566-10mg	EnQuireBio	10mg	EUR 155

Recombinant other SST Protein, Untagged, E.coli-10mg
QP13598-10mg	EnQuireBio	10mg	EUR 201

Recombinant Rabbit TNC Protein, Untagged, Rabbit-10mg
QP13765-10mg	EnQuireBio	10mg	EUR 1061

Recombinant other Avidin Biotin Protein, Untagged, -10mg
QP10526-10mg	EnQuireBio	10mg	EUR 201

Recombinant Human CTRB1 Protein, Untagged, E.coli-10mg
QP10565-10mg	EnQuireBio	10mg	EUR 201

Polyclonal Goat anti-GST α-form
GST-ANTI-1	Detroit R&D	50 uL	EUR 280

Recombinant Human Ferritin Protein, Untagged, Native Protein-10mg
QP11867-10mg	EnQuireBio	10mg	EUR 2158

Recombinant Bovine Fibronectin Protein, Untagged, Native Protein-10mg
QP11880-10mg	EnQuireBio	10mg	EUR 1017

Recombinant Human Fibronectin Protein, Untagged, Native Protein-10mg
QP11881-10mg	EnQuireBio	10mg	EUR 1017

Recombinant Human Haptoglobin Protein, Untagged, Native Protein-10mg
QP12103-10mg	EnQuireBio	10mg	EUR 1959

Recombinant Human HbA1c Protein, Untagged, Native Protein-10mg
QP12117-10mg	EnQuireBio	10mg	EUR 2259

Recombinant Human HDL Protein, Untagged, Native Protein-10mg
QP12211-10mg	EnQuireBio	10mg	EUR 201

Recombinant other HSA Protein, Untagged, Pichia Pastoris-10mg
QP12314-10mg	EnQuireBio	10mg	EUR 155

Recombinant other HSA Recombinant Protein, Untagged, Rice-10mg
QP12317-10mg	EnQuireBio	10mg	EUR 163

Recombinant Human LDL Protein, Untagged, Native Protein-10mg
QP12550-10mg	EnQuireBio	10mg	EUR 163

Recombinant Human LTF Protein, Untagged, Native Protein-10mg
QP12595-10mg	EnQuireBio	10mg	EUR 4851

Recombinant Human LTF Holo Protein, Untagged, Rice-10mg
QP12596-10mg	EnQuireBio	10mg	EUR 155

Recombinant Human Myoglobin Protein, Untagged, Native Protein-10mg
QP12776-10mg	EnQuireBio	10mg	EUR 2059

Recombinant other Protein-L Protein, Untagged, E.coli-10mg
QP13168-10mg	EnQuireBio	10mg	EUR 201

Recombinant other Lipase A Protein, Untagged, E.coli-10mg
QP10772-10mg	EnQuireBio	10mg	EUR 155

Recombinant Human MG Protein, Untagged, Native Protein-10mg
QP10785-10mg	EnQuireBio	10mg	EUR 490

Recombinant Bovine Trypsin Protein, Untagged, Native Protein-10mg
QP10896-10mg	EnQuireBio	10mg	EUR 201

Recombinant Human UTI Protein, Untagged, Native Protein-10mg
QP10909-10mg	EnQuireBio	10mg	EUR 209

Recombinant Human A2M Protein, Untagged, Native Protein-10mg
QP10922-10mg	EnQuireBio	10mg	EUR 1624

Recombinant Human APOB Protein, Untagged, Native Protein-10mg
QP11047-10mg	EnQuireBio	10mg	EUR 4553

Recombinant Human B2M Protein, Untagged, Native Protein-10mg
QP11117-10mg	EnQuireBio	10mg	EUR 1415

Recombinant Human C1q Protein, Untagged, Native Protein-10mg
QP11228-10mg	EnQuireBio	10mg	EUR 4553

Recombinant Human C3c Protein, Untagged, Native Protein-10mg
QP11238-10mg	EnQuireBio	10mg	EUR 1161

Recombinant Human C4c Protein, Untagged, Native Protein-10mg
QP11240-10mg	EnQuireBio	10mg	EUR 3556

Recombinant Human CKM Protein, Untagged, Native Protein-10mg
QP11436-10mg	EnQuireBio	10mg	EUR 4806

Recombinant Human CRP Protein, Untagged, Native Protein-10mg
QP11511-10mg	EnQuireBio	10mg	EUR 916

Recombinant other SPA 33.4kDa Protein, Untagged, E.coli-10mg
QP13567-10mg	EnQuireBio	10mg	EUR 155

Recombinant other SPA Long Protein, Untagged, E.coli-10mg
QP13568-10mg	EnQuireBio	10mg	EUR 155

Recombinant other SPA-Cys Protein, Untagged, E.coli-10mg
QP13569-10mg	EnQuireBio	10mg	EUR 155

Recombinant other Streptavidin Protein, Untagged, Native Protein-10mg
QP13625-10mg	EnQuireBio	10mg	EUR 201

Recombinant Multi Species Trp Protein, Untagged, E.coli-10mg
QP13821-10mg	EnQuireBio	10mg	EUR 245

Recombinant other hCG Protein, Untagged, Native Protein-10mg
QP10664-10mg	EnQuireBio	10mg	EUR 245

Recombinant other HSA Lipid free Protein, Untagged, Rice-10mg
QP12316-10mg	EnQuireBio	10mg	EUR 163

Recombinant other Protein-A/G Protein, His, E.coli-10mg
QP13163-10mg	EnQuireBio	10mg	EUR 201

Recombinant other Protein-G His Protein, His, E.coli-10mg
QP13167-10mg	EnQuireBio	10mg	EUR 318

Recombinant other Protein-L Cys Protein, Untagged, E.coli-10mg
QP13169-10mg	EnQuireBio	10mg	EUR 201

Recombinant Human Collagen-III Protein, Untagged, Pichia Pastoris-10mg
QP11479-10mg	EnQuireBio	10mg	EUR 281

Recombinant other Cys-Protein-G Protein, Untagged, E.coli-10mg
QP11587-10mg	EnQuireBio	10mg	EUR 318

Recombinant other Cys-Protein-L Protein, Untagged, E.coli-10mg
QP11588-10mg	EnQuireBio	10mg	EUR 201

Recombinant other SPA-Cys His Protein, His, E.coli-10mg
QP13570-10mg	EnQuireBio	10mg	EUR 155

Recombinant other SPA-Cys Long Protein, Untagged, E.coli-10mg
QP13571-10mg	EnQuireBio	10mg	EUR 155

Recombinant other Protein Cys-A/G Protein, Untagged, E.coli-10mg
QP13161-10mg	EnQuireBio	10mg	EUR 201

Recombinant other Protein-A/G Cys Protein, Untagged, E.coli-10mg
QP13164-10mg	EnQuireBio	10mg	EUR 201

Recombinant other Protein-A/G/L Protein, Untagged, E.coli-10mg
QP13165-10mg	EnQuireBio	10mg	EUR 327

Recombinant other Protein-A/G/L-Cys Protein, Untagged, E.coli-10mg
QP13166-10mg	EnQuireBio	10mg	EUR 327

Recombinant other Cys-Protein-A/G/L Protein, Untagged, E.coli-10mg
QP11586-10mg	EnQuireBio	10mg	EUR 327

Rabbit Polyclonal antibody Anti-CRBN
Anti-CRBN	ImmunoStep	50 µg	EUR 349

Anti-inflammatory agent 1
HY-U00273	MedChemExpress	10mg	EUR 1455

Anti-Macrophage Inflammatory Protein 3 beta/Ccl19 Antibody
A01605-1	BosterBio	100ug/vial	EUR 294

anti-Macrophage Inflammatory Protein 1
YF-PA14542	Abfrontier	50 ug	EUR 363
Description: Mouse polyclonal to Macrophage Inflammatory Protein 1

anti-Macrophage Inflammatory Protein 1
YF-PA24668	Abfrontier	50 ul	EUR 334
Description: Mouse polyclonal to Macrophage Inflammatory Protein 1

Anti-Peptide YY/PYY Antibody
A04223-1	BosterBio	100ug/vial	EUR 334

Anti-Macrophage Inflammatory Protein 1 (4E7)
YF-MA10821	Abfrontier	100 ug	EUR 363
Description: Mouse monoclonal to Macrophage Inflammatory Protein 1

anti-Macrophage Inflammatory Protein 1 beta
YF-PA14543	Abfrontier	100 ug	EUR 403
Description: Rabbit polyclonal to Macrophage Inflammatory Protein 1 beta

anti-Macrophage Inflammatory Protein 1 beta
YF-PA24669	Abfrontier	50 ul	EUR 334
Description: Mouse polyclonal to Macrophage Inflammatory Protein 1 beta

Biotin-DHPE: (10mg)
60022	Biotium	10MG	EUR 237
Description: Minimum order quantity: 1 unit of 10MG

Cellmaxin, 10mg/ml
C3314-006	GenDepot	6x1ml	EUR 212

Cellmaxin, 10mg/ml
C3314-020	GenDepot	20ml	EUR 327

Polyclonal Goat anti-GST μ-form
GST-ANTI-2	Detroit R&D	50 uL	EUR 280

Polyclonal Goat anti-GST p-form
GST-ANTI-3	Detroit R&D	50 uL	EUR 280

Anti-inflammatory agent 2
HY-U00299	MedChemExpress	20mg	EUR 4803

MIP-1a Macrophage Inflammatory Protein-1 Alpha Mouse Recombinant Protein (CCL3)
PROTP10855-1	BosterBio	Regular: 10ug	EUR 317
Description: Macrophage Inflammatory Protein-1 alpha Mouse Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 69 amino acids and having a molecular mass of 7820 Dalton. ;The MIP-1a is purified by proprietary chromatographic techniques.

HIV-1 Tat Protein Peptide
B1433-1	ApexBio	1 mg	EUR 128
Description: HIV-1 Tat Protein Peptide

Amyloid ?-Peptide (1-42) (human)
B6057-.1	ApexBio	100 ug	EUR 276

Hydroxystilbamidine (Fluoro-Gold): (10mg)
80014	Biotium	10MG	EUR 253
Description: Minimum order quantity: 1 unit of 10MG

Transferrin Solution, 10mg/ml
CA205-005	GenDepot	5x1ml	EUR 115

MIP-1a Macrophage Inflammatory Protein-1 Alpha Human Recombinant Protein (CCL3), His Tag
PROTP10147-1	BosterBio	Regular: 10ug	EUR 317
Description: Macrophage Inflammatory Protein-1 alpha His Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 68 amino acids and having a molecular mass of 7820 Dalton with an amino-terminal hexahistidine tag. ;The MIP-1a-His is purified by proprietary chromatographic techniques.

Lytic Peptide, Shiva ? 1
SP-88327-1	Alpha Diagnostics	1 mg	EUR 347

anti-Macrophage inflammatory protein 5
YF-PA20144	Abfrontier	50 ug	EUR 363
Description: Mouse polyclonal to Macrophage inflammatory protein 5

anti-Macrophage inflammatory protein 5
YF-PA20145	Abfrontier	100 ul	EUR 403
Description: Rabbit polyclonal to Macrophage inflammatory protein 5

anti-Macrophage inflammatory protein 5
YF-PA20146	Abfrontier	100 ug	EUR 403
Description: Rabbit polyclonal to Macrophage inflammatory protein 5

anti-Macrophage inflammatory protein 5
YF-PA14551	Abfrontier	100 ul	EUR 403
Description: Rabbit polyclonal to Macrophage inflammatory protein 5

anti-Macrophage inflammatory protein 5
YF-PA14552	Abfrontier	100 ug	EUR 403
Description: Rabbit polyclonal to Macrophage inflammatory protein 5

anti-Macrophage Inflammatory Protein 4
YF-PA14553	Abfrontier	100 ul	EUR 403
Description: Rabbit polyclonal to Macrophage Inflammatory Protein 4

anti-Macrophage Inflammatory Protein 4
YF-PA14554	Abfrontier	100 ug	EUR 403
Description: Rabbit polyclonal to Macrophage Inflammatory Protein 4

anti-Macrophage Inflammatory Protein 3
YF-PA14559	Abfrontier	50 ug	EUR 363
Description: Mouse polyclonal to Macrophage Inflammatory Protein 3

anti-Macrophage Inflammatory Protein 3
YF-PA14560	Abfrontier	100 ul	EUR 403
Description: Rabbit polyclonal to Macrophage Inflammatory Protein 3

anti-Macrophage Inflammatory Protein 3
YF-PA14561	Abfrontier	100 ug	EUR 403
Description: Rabbit polyclonal to Macrophage Inflammatory Protein 3

anti-Macrophage inflammatory protein 5
YF-PA24672	Abfrontier	50 ul	EUR 334
Description: Mouse polyclonal to Macrophage inflammatory protein 5

anti-Macrophage Inflammatory Protein 4
YF-PA24674	Abfrontier	50 ul	EUR 334
Description: Mouse polyclonal to Macrophage Inflammatory Protein 4

Amyloid Beta-Peptide (1-40) (human)
A1124-1	ApexBio	1 mg	EUR 189
Description: Amyloid ?-Peptide (1-40) (human), (C194H295N53O58S1), a peptide with the sequence H2N-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA-OH, MW= 4329.8. Amyloid beta (A? or Abeta) is a peptide of 36-43 amino acids that is processed from the Amyloid precursor protein.

YAP-TEAD Inhibitor 1 (Peptide 17)
A1149-1	ApexBio	1 mg	EUR 235

Brain natriuretic peptide (1-32) (human)
B5442-1	ApexBio	1 mg	EUR 518

Anti-Macrophage Inflammatory Protein 1 beta/CCL4 Antibody
PA1379	BosterBio	100ug/vial	EUR 294

Anti-CCL3/Macrophage Inflammatory Protein 1 alpha Antibody
PB9022	BosterBio	100ug/vial	EUR 294

Anti-Macrophage Inflammatory Protein 1 beta/CCL4 Antibody
PB9064	BosterBio	100ug/vial	EUR 294

Anti-CCL3/Macrophage Inflammatory Protein 1 alpha Antibody
PB9571	BosterBio	100ug/vial	EUR 294

Anti-Macrophage Inflammatory Protein 1 beta?/CCL4 Antibody
PB9572	BosterBio	100ug/vial	EUR 294

Cathelicidin Anti-microbial peptide (CAP-18), rabbit
SP-88322-1	Alpha Diagnostics	1 mg	EUR 347

3, 6-dioxaoctane-1, 8-diyl dimethanethiosulfonate:10mg
91042	Biotium	10MG	EUR 151
Description: Minimum order quantity: 1 unit of 10MG

GnRH Associated Peptide (GAP) (1-13), human
A1020-1	ApexBio	1 mg	EUR 90
Description: Sequence: Asp-Ala-Glu-Asn-Leu-Ile-Asp-Ser-Phe-Gln-Glu-Ile-ValThe cloned complementary DNA sequence encoding the human gonadotropin-releasing hormone (GnRH) precursor protein was used to construct an expression vector for the bacterial synthesis of the 56-amino acid GnRH-associated peptide (GAP).

Dihydrorhodamine 123, dihydrochloride salt: (10mg)
10056	Biotium	10MG	EUR 191
Description: Minimum order quantity: 1 unit of 10MG

DAPI, 10mg/mL in H2O
40043	Biotium	1ML	EUR 134
Description: Minimum order quantity: 1 unit of 1ML

RNase A Solution (10mg/ml)
RB0474	Bio Basic	1ml	EUR 55.22
Product category: Proteins/Enzymes/Endonucleases

Anti-Periphilin 1 Antibody
A06996-1	BosterBio	100ul	EUR 397
Description: Rabbit Polyclonal Antibody for Periphilin 1 Antibody (PPHLN1) detection.tested for WB in Human, Mouse.

Anti-Lyl-1 Antibody
A07491-1	BosterBio	100ul	EUR 397
Description: Rabbit Polyclonal Lyl-1 Antibody. Validated in IHC and tested in Human, Mouse, Rat.

Anti-GLI-1 Antibody
A07972-1	BosterBio	100ul	EUR 397
Description: Rabbit Polyclonal Antibody for GLI-1 Antibody (ACSS1) detection. Tested with WB in Human, Mouse, Rat.

Anti-Cerebellin 1 Antibody
A09176-1	BosterBio	100ul	EUR 397
Description: Rabbit Polyclonal Antibody for Cerebellin 1 Antibody (CBLN1) detection. Tested with WB in Human, Mouse, Rat.

Mediation outcomes confirmed that trait anxiousness predicted such outcomes whereas the protecting position of mindfulness aspects in mitigating these results was important solely at Time 2. Cultivating consciousness and nonjudgmental acceptance of 1’s interior experiences is an important self-regulation useful resource that may assist medical college students maintain their wellbeing as they be taught and all through their high-pressure training and skilled careers.

Medical students as adverse drug event managers, learning about side effects while improving their reporting in clinical practice

Managing adverse drug reactions (ADRs) is a problem, particularly as a result of most healthcare professionals are insufficiently educated for this process. Since context-based clinical pharmacovigilance coaching has confirmed efficient, we assessed the feasibility and impact of a making a crew of Junior-Adverse Drug Event Managers (J-ADEMs). The J-ADEM crew consisted of medical students (1st-Sixth 12 months) tasked with managing and reporting ADRs in hospitalized sufferers. Feasibility was evaluated utilizing questionnaires. Student competence in reporting ADRs was evaluated utilizing a case-control design and questionnaires earlier than and after J-ADEM program participation.

From Augustus 2018 to Augustus 2019, 41 students participated in a J-ADEM crew and screened 136 sufferers and submitted 65 ADRs experiences to the Netherlands Pharmacovigilance Center Lareb. Almost all sufferers (n = 61) discovered it vital that “their” ADR was reported, and all (n = 62) sufferers felt they had been taken critically by the J-ADEM crew. Although attending physicians agreed that the ADRs ought to have been reported, they didn’t achieve this themselves primarily due to a “lack of awareness and attitudes” (50%) and “excuses made by healthcare professionals” (49%). J-ADEM crew students had been considerably extra competent than management students in managing ADRs and accurately making use of all steps for diagnosing ADRs (management group 38.5% vs. intervention group 83.3%, p < 0.001).

The J-ADEM crew is a possible method for detecting and managing ADRs in hospital. Patients had been happy with the care supplied, physicians had been supported in their ADR reporting obligations, and students acquired related fundamental and clinical pharmacovigilance abilities and information, making it a win-win-win intervention. A 3-h workshop, aimed to critically appraise analysis papers, reviewed cervical and ovarian most cancers screening strategies. The workshop was facilitated by a Consultant in Gynae-oncology Surgery. Anonymous analysis was requested from 200 9 students attending through the 2018/2019 educational 12 months. Qualitative analysis with thematic evaluation of content material was carried out.

One hundred fifty-six students gave analysis on the workshop itself (74.6%). Three important themes had been identified-support for the significance of instructing screening strategies, appreciation of the significance of understanding cervical screening and a want for additional instructing in Critical Appraisal. Students recognized that there was a necessity to know screening, that it was “..vital for us to think about the worth of screening programmes”. The instructing on Cervical screening was “..useful, particularly with cervical screening”.

Initial Resuscitation of a Multisystem Trauma Patient Following a Fall From Height: A Complete Simulation Scenario for Medical Students

Management of a fancy trauma affected person is a crucial talent for medical students, significantly throughout a common surgical procedure or emergency medication clerkship. However, gaining proficiency with this skillset could also be difficult with out prior medical or simulation expertise. The purpose of this technical report is to current a complete high-fidelity medical simulation of a polytraumatized affected person with quite a few accidents sustained from a 20-foot fall.

As the situation unfolds, students determine multisystem accidents together with acute hemorrhage, femur fracture, pressure pneumothorax, and traumatic mind harm. The case was designed as an evaluation device to guage the information of preclinical medical students obtained by way of a one-day workshop on the first survey. This technical report supplies simulation designers with a premade script, flowchart, labs, pictures, and provides wanted to efficiently recreate the case.

Medical students as adverse drug event managers, learning about side effects while improving their reporting in clinical practice

Medical Student Ultrasound Education: The Radiology Chair Weighs In

To assess the radiology division chairs’ opinions regarding present standing and plans for instructing ultrasound to medical students, the American College Taskforce on Radiology Ultrasound Education, commissioned by the American College of Radiology, distributed a survey to 142 radiology chairs and a medical college dean subgroup.The response price was 30% (42/142), and 76% indicated ultrasound was presently a part of the medical pupil curriculum. In preclinical years, radiology involvement was solely 6.4%. During clinical years, radiology led ultrasound schooling with 51.7% in common and 82.9% in elective rotations.

Regarding precise content material, prime Four outcomes had been evenly distributed between learning hands-on scanning (81.1%), diagnostic use of ultrasound (75.7%), anatomy/pathology (75.7%), and ultrasound steerage for procedures (54.0%). Educational leaders in preclinical programs had been emergency medication (72.7%) adopted by radiology (45.4%) physicians. During clinical years, leaders had been radiology (52.6%) and emergency medication (47.4%) physicians.

Most chairs said that information of diagnostic ultrasound ought to be necessary (76.2%), stressing the significance of instructing the diagnostic capabilities and makes use of of ultrasound as the first purpose (78.8%). Perceived boundaries to implementation had been evenly distributed between lack of area in the curriculum (55.6%), lack of college (48.2%), lack of assets (44.4%), and lack of institutional help (40.7%). The American College Taskforce on Radiology Ultrasound Education survey exhibits that radiology’s position in ultrasound undergraduate schooling happens nearly completely throughout clinical years, and the chairs voice a want to enhance upon this position. Barriers embrace each intradepartmental (college and assets) and institutional (curricular) elements.

For medical faculties, the COVID-19 pandemic necessitated examination and curricular restructuring as effectively as vital adjustments to clinical attachments. With the obtainable proof suggesting that medical students’ psychological well being standing is already poorer than that of the final inhabitants, with educational stress being a chief predictor, such adjustments are more likely to have a major impact on these students.

alpha-1 antitrypsin fragment
A1051-1	ApexBio	1 mg	EUR 108
Description: Alpha-1 antitrypsin (A1AT) (H2N-Leu-Gln-His-Leu-Glu-Asn-Glu-Leu-Thr-His-Asp-Ile-Ile-Thr-Lys-OH), which is known as serum trypsin inhibitor, is a protease inhibitor belonging to the serpin superfamily.

Thrombin Sepharose Beads
7925-1	Biovision		EUR 218

Pannexin 1 Fragment (4515) Peptide
20-abx266300	Abbexa	EUR 495.00 EUR 815.00 EUR 356.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

Pannexin 1 Fragment (4512) Peptide
20-abx266362	Abbexa	EUR 523.00 EUR 871.00 EUR 384.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

Lamin fragment
A1077-1	ApexBio	1 mg	EUR 108
Description: Lamin fragment has a peptide sequence of Lys-Ala-Gly-Gln-Val-Val-Thr-Ile-Trp.

transferrin fragment
A1093-1	ApexBio	1 mg	EUR 108
Description: Transferrin is the principal ironbinding protein in animal serum and is analogous in its iron-binding site and properties to lactoferrin1. Human transferrin is a single-chain glycoprotein of molecular weight near 80,000.

Thrombin Receptor Blocking Peptide
AF0263-BP	Affbiotech	1mg	EUR 195

Thrombin Receptor Agonist Peptide
A8668-10	ApexBio	10 mg	EUR 1118
Description: Agonist at the thrombin receptor; causes platelet aggregation (EC50 = 4 ?M) and secretion.

Thrombin Receptor Agonist Peptide
A8668-5	ApexBio	5 mg	EUR 651
Description: Agonist at the thrombin receptor; causes platelet aggregation (EC50 = 4 ?M) and secretion.

Thrombin Receptor Agonist Peptide
A8668-5.1	ApexBio	10 mM (in 1mL DMSO)	EUR 2267
Description: Agonist at the thrombin receptor; causes platelet aggregation (EC50 = 4 ?M) and secretion.

Anti-PAR1/Thrombin Receptor/F2R Antibody
A03352-1	BosterBio	100ug/vial	EUR 334

Thrombin Human Recombinant Protein
PROTP00734-1	BosterBio	Regular: 20ug	EUR 317
Description: Thrombin Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 296 amino acids (328-622) and having a molecular mass of 33.9 kDa.

Rac GTPase fragment
A1086-1	ApexBio	1 mg	EUR 108
Description: Rac GTPase fragment, (C46H74N12O14), a peptide with the sequence H2N-Val-Phe-Asp-Glu-Ala-Ile-Arg-Ala-Val-OH, MW= 1019.15. Rac is a subfamily of the Rho family of GTPases, small signaling G proteins (more specifically a GTPase).

Trypsinogen Activation Peptide (TAP) Antibody
20-abx103074	Abbexa	EUR 398.00 EUR 133.00 EUR 1107.00 EUR 537.00 EUR 314.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Trypsinogen Activation Peptide (TAP) Antibody
20-abx174951	Abbexa	EUR 787.00 EUR 411.00	1 mg 200 ug
Please enquire.

HIV-gp41-Fragment Peptide
20-abx265740	Abbexa	EUR 328.00 EUR 495.00 EUR 272.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

Scrambled TRAP Fragment Peptide
20-abx265858	Abbexa	EUR 356.00 EUR 537.00 EUR 286.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

Collagen Binding Fragment Peptide
20-abx266190	Abbexa	EUR 439.00 EUR 718.00 EUR 328.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

P75 TNFR Fragment Peptide
20-abx266292	Abbexa	EUR 495.00 EUR 815.00 EUR 356.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

Gastric Juice Peptide Fragment
H-2074.0500	Bachem	0.5mg	EUR 113
Description: Sum Formula: C62H98N16O22; CAS# [137525-51-0]

Gastric Juice Peptide Fragment
H-2074.1000	Bachem	1.0mg	EUR 171
Description: Sum Formula: C62H98N16O22; CAS# [137525-51-0]

Human Thrombin AssayMax ELISA Kit
ET4010-1	AssayPro	96 Well Plate	EUR 417

Anti-Thrombin III Blocking Peptide
20-abx161017	Abbexa	EUR 272.00 EUR 411.00	1 mg 5 mg
Shipped within 5-10 working days.

Influenza A virus fragment
A1075-1	ApexBio	1 mg	EUR 96
Description: Influenza A virus fragment has the RNA sequence of Leu-Lys-Phe-Ala-Phe-Ser-Met-Met.Influenzavirus A is agenusof the Orthomyxoviridaefamily of viruses.

p53 tumor suppressor fragment
A1083-1	ApexBio	1 mg	EUR 108
Description: p53 tumor suppressor fragment (232-240),(C41H67N11O14S4), a peptide with the sequence H2N-Lys-Tyr-Met-Cys-Asn-Ser-Ser-Cys-Met-OH, MW= 1066.3. p53 (also known as protein 53 or tumor protein 53), is a tumor suppressor protein that in humans is encoded by the TP53 gene(1).

type II collagen fragment
A1096-1	ApexBio	1 mg	EUR 108
Description: Type II collagen is composed of a triple helix of three identical ? chains. These molecules associate to form a fibril that is stabilized by intermolecular crosslinks1.

PKC fragment (530-558)
B5213-1	ApexBio	1 mg	EUR 297

coagulation factor II (thrombin) B chain fragment [Homo sapiens]
A1057-10	ApexBio	10 mg	EUR 340
Description: Thrombin (H2N-Lys-Pro-Val-Ala-Phe-Ser-Asp-Tyr-Ile-His-Pro-Val-Cys-Leu-Pro-Asp-Arg-OH) is a "trypsin-like" serine protease that is encoded by the F2 gene in humans. [1] Thrombin is produced by the enzymatic cleavage of two sites on prothrombin by activated Factor X (Xa).

coagulation factor II (thrombin) B chain fragment [Homo sapiens]
A1057-25	ApexBio	25 mg	EUR 456
Description: Thrombin (H2N-Lys-Pro-Val-Ala-Phe-Ser-Asp-Tyr-Ile-His-Pro-Val-Cys-Leu-Pro-Asp-Arg-OH) is a "trypsin-like" serine protease that is encoded by the F2 gene in humans. [1] Thrombin is produced by the enzymatic cleavage of two sites on prothrombin by activated Factor X (Xa).

coagulation factor II (thrombin) B chain fragment [Homo sapiens]
A1057-5	ApexBio	5 mg	EUR 224
Description: Thrombin (H2N-Lys-Pro-Val-Ala-Phe-Ser-Asp-Tyr-Ile-His-Pro-Val-Cys-Leu-Pro-Asp-Arg-OH) is a "trypsin-like" serine protease that is encoded by the F2 gene in humans. [1] Thrombin is produced by the enzymatic cleavage of two sites on prothrombin by activated Factor X (Xa).

Cytokeratin Fragment Antigen 21-1 Peptide (OVA)
20-abx165524	Abbexa	EUR 578.00 EUR 258.00 EUR 1720.00 EUR 690.00 EUR 425.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Thrombin antibody
20R-1363	Fitzgerald	10 mg	EUR 281
Description: Sheep polyclonal Thrombin antibody

Thrombin antibody
20R-1364	Fitzgerald	10 mg	EUR 247
Description: Sheep polyclonal Thrombin antibody

Thrombin antibody
20R-1372	Fitzgerald	10 mg	EUR 281
Description: Sheep polyclonal Thrombin antibody

Thrombin antibody
70R-10615	Fitzgerald	500 ug	EUR 529
Description: Affinity purified sheep polyclonal Thrombin antibody

Thrombin antibody
70R-10617	Fitzgerald	500 ug	EUR 541
Description: Affinity purified sheep polyclonal Thrombin antibody

Thrombin Antibody
6685-100	Biovision		EUR 338

Thrombin Antibody
6685-30T	Biovision		EUR 146

Thrombin antibody
70R-TS001	Fitzgerald	500 ug	EUR 529
Description: Affinity purified sheep polyclonal Thrombin antibody

Thrombin Antibody
abx022382-05mg	Abbexa	0.5 mg	EUR 1156
Shipped within 5-10 working days.

Thrombin Antibody
abx022419-100ug	Abbexa	100 ug	EUR 425
Shipped within 5-10 working days.

Trypsinogen Activation Peptide (TAP) Antibody (Biotin)
20-abx272518	Abbexa	EUR 425.00 EUR 230.00 EUR 1191.00 EUR 578.00 EUR 328.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-15 working days.

EZAct? Procathepsin Activation Buffer
1030-1	Biovision		EUR 153

Thrombin, Active, Bovine Plasma (Technical grade)
7591-1	Biovision		EUR 120

Thrombin, Active, Bovine Plasma (High Activity)
7592-1	Biovision		EUR 158

Anti-Fibroblast activation protein, alpha/FAP Antibody
A00422-1	BosterBio	100ug/vial	EUR 294

Thrombin inhibitor 1
HY-U00370	MedChemExpress	1mg	EUR 2337

Rac1 Activation Assay
STA-401-1	Cell Biolabs	20 assays	EUR 757
Description: Our Rac Activation Assays use visible agarose beads to selectively precipitate the active form of Rac1 or Rac2. The precipitated small GTPase is then detected by Western blot using a Rac1- or Rac2-specific antibody included in the kit.

Arf1 Activation Assay
STA-407-1	Cell Biolabs	20 assays	EUR 757
Description: Our Arf Activation Assays use visible agarose beads to selectively precipitate the active form of Arf1 or Arf 6. The precipitated small GTPase is then detected by Western blot using an Arf1- or Arf6-specific antibody included in the kit.

Cytochrome c fragment (93-108)
A1062-1	ApexBio	1 mg	EUR 137
Description: H2N-ANERADLIAYLKQATK-OHTheCytochrome cis a smallhemeproteinfound loosely associated with the inner membrane of themitochondrion. Cytochromes c from certain eukaryotes, including plants and fungi but not higher animals, contains methylated lysine residues at specific positions1.

MAP kinase fragment [Multiple species]
A1079-1	ApexBio	1 mg	EUR 108
Description: This Mitogen-activated protein kinase (MAP kinase) fragment has a peptide sequence of Lys-Tyr-Ile-His-Ser-Ala-Asn-Val-Leu.The MAP kinases are serine/threonine-specific protein kinasesbelonging to the CMGC (CDK/MAPK/GSK3/CLK) kinase group.

ubiquitin specific protease 3 fragment
A1097-1	ApexBio	1 mg	EUR 108
Description: The ubiquitin speci?c protease 3 USP3 is a deubiquitinating enzyme for uH2A and uH2B. USP3 dynamically associates with chromatin and deubiquitinates H2A/H2B in vivo.

Prothrombin fragment 1 antibody
70R-10602	Fitzgerald	500 ug	EUR 492
Description: Affinity purified sheep polyclonal Prothrombin fragment 1 antibody

Human Trypsinogen Activation Peptide (TAP) Peptide (BSA)
20-abx651098	Abbexa	EUR 258.00 EUR 189.00 EUR 537.00 EUR 272.00 EUR 217.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Human Trypsinogen Activation Peptide (TAP) Peptide (OVA)
20-abx651099	Abbexa	EUR 258.00 EUR 189.00 EUR 537.00 EUR 272.00 EUR 217.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Mouse Trypsinogen Activation Peptide (TAP) Peptide (BSA)
20-abx651100	Abbexa	EUR 258.00 EUR 189.00 EUR 537.00 EUR 272.00 EUR 217.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Mouse Trypsinogen Activation Peptide (TAP) Peptide (OVA)
20-abx651101	Abbexa	EUR 258.00 EUR 189.00 EUR 537.00 EUR 272.00 EUR 217.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Rat Trypsinogen Activation Peptide (TAP) Peptide (BSA)
20-abx651102	Abbexa	EUR 258.00 EUR 189.00 EUR 537.00 EUR 272.00 EUR 217.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Rat Trypsinogen Activation Peptide (TAP) Peptide (OVA)
20-abx651103	Abbexa	EUR 258.00 EUR 189.00 EUR 537.00 EUR 272.00 EUR 217.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-7 working days.

Trypsinogen Activation Peptide (TAP) Polyclonal Antibody (Human)
4-PAA634Hu01	Cloud-Clone	EUR 232.00 EUR 2285.00 EUR 574.00 EUR 289.00 EUR 208.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: OVA conjugated Trypsinogen Activation Peptide(TAP) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Trypsinogen Activation Peptide (TAP)

GTP-Binding Protein Fragment, G alpha
A1022-1	ApexBio	1 mg	EUR 90
Description: Sequence: Cys-Gly-Ala-Gly-Glu-Ser-Gly-Lys-Ser-Thr-Ile-Val-Lys-Gln-Met-LysUsing specific antisera raised against synthetic peptides, we find that three distinct GTP-binding protein alpha subunits remain bound to the plasma membrane even after activation with nonhydrolyzable GTP analog.

amyloid A protein fragment [Homo sapiens]
A1053-1	ApexBio	1 mg	EUR 108
Description: Amyloid A proteins (H2N-Ala-Gly-Leu-Pro-Glu-Lys-Tyr-OH), also called Serum amyloid A (SSA) proteins, are a family of apolipoproteins associated with high-density lipoprotein (HDL) in plasma.

ferritin heavy chain fragment [Multiple species]
A1069-1	ApexBio	1 mg	EUR 108
Description: Sequence: H2N-YLNEQVKAI-OHThe two heavy chains are colored red and blue and the two light chains green and yellow.Ferritin is a protein of 450 kDa consisting of 24 subunits that is present in every cell type.

PKA inhibitor fragment (6-22) amide
A1117-1	ApexBio	1 mg	EUR 131
Description: Ki: 1.6 nMPKA inhibitor fragment (6-22) amide is a PKA inhibitor. In cell biology, protein kinase A (PKA) is a family of enzymes whose activity is dependent on cellular levels of cyclic AMP (cAMP). PKA is also regarded as a cAMP-dependent protein kinase.

Human beta-Amyloid 25-35 fragment
BAM2535-1	Alpha Diagnostics	1 mg	EUR 408

Thrombin
HY-114164	MedChemExpress	500ug	EUR 119

Rap1 Activation Assay Kit
STA-406-1	Cell Biolabs	20 assays	EUR 757
Description: Our Rap Activation Assays use visible agarose beads to selectively precipitate the active form of Rap1 or Rap2. The precipitated small GTPase is then detected by Western blot using a Rap1- or Rap2-specific antibody included in the kit.

Human Thrombin-Antithrombin Complex (TAT) AssayMax ELISA Kit
ET1020-1	AssayPro	96 Well Plate	EUR 417

Mouse Thrombin-Antithrombin (TAT) Complex AssayMax ELISA Kit
EMT1020-1	AssayPro	96 Well Plate	EUR 417

Thrombin Receptor antibody
70R-30775	Fitzgerald	100 ug	EUR 327
Description: Rabbit polyclonal Thrombin Receptor antibody

Thrombin Receptor Antibody
33500-100ul	SAB	100ul	EUR 252

Thrombin Receptor Antibody
33500-50ul	SAB	50ul	EUR 187

Human Thrombin Antibody
35147-05111	AssayPro	150 ug	EUR 261

Human Thrombin Antibody
11571-05011	AssayPro	150 ug	EUR 217

Thrombin antibody (HRP)
60R-1045	Fitzgerald	200 ug	EUR 418
Description: Sheep polyclonal Thrombin antibody (HRP) conjugated

Thrombin antibody (FITC)
60R-1046	Fitzgerald	100 ug	EUR 418
Description: Sheep polyclonal Thrombin antibody (FITC) conjugated

Thrombin antibody (biotin)
60R-1047	Fitzgerald	100 ug	EUR 418
Description: Sheep polyclonal Thrombin antibody (biotin) conjugated

Thrombin antibody (HRP)
60R-1048	Fitzgerald	200 ug	EUR 448
Description: Sheep polyclonal Thrombin antibody (HRP) conjugated

Thrombin antibody (HRP)
60R-1078	Fitzgerald	200 ug	EUR 445
Description: Sheep polyclonal Thrombin antibody (HRP) conjugated

Polyclonal Thrombin Antibody
APR10458G	Leading Biology	0.1mg	EUR 484
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human Thrombin . This antibody is tested and proven to work in the following applications:

Thrombin III Antibody
abx023271-10ml	Abbexa	10 ml	EUR 411
Shipped within 5-10 working days.

Thrombin III Antibody
abx023272-1ml	Abbexa	1 ml	EUR 565
Shipped within 5-10 working days.

Thrombin III Antibody
20-abx121017	Abbexa	EUR 300.00 EUR 439.00 EUR 189.00	100 ul 200 ul 30 ul
Shipped within 5-10 working days.

Thrombin Receptor Antibody
AF0263	Affbiotech	200ul	EUR 304
Description: Thrombin Receptor antibody detects endogenous levels of total Thrombin Receptor.

Thrombin Receptor Antibody
ABF0263	Lifescience Market	100 ug	EUR 438

Morphine Modulating Peptide, C-Terminal Fragment
5-01561	CHI Scientific	4 x 5mg	Ask for price

Morphine Modulating Peptide, C-Terminal Fragment
20-abx265838	Abbexa	EUR 356.00 EUR 537.00 EUR 286.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

HIV-gp120-Fragment (318-327) Peptide
20-abx266178	Abbexa	EUR 439.00 EUR 718.00 EUR 328.00	10 mg 25 mg 5 mg
Shipped within 5-10 working days.

Human IgG Fab fragment, purified
20007-1-FAB	Alpha Diagnostics	1 mg	EUR 202

Human IgG (Fc) fragment, purified
20007-1-FC	Alpha Diagnostics	0.5 mg	EUR 208

Mouse IgG Fab fragment, purified
20008-1-FAB	Alpha Diagnostics	1 mg	EUR 164

Mouse IgG (Fc) fragment, purified
20008-1-FC	Alpha Diagnostics	0.5 mg	EUR 250

Rabbit IgG Fab fragment, purified
20009-1-FAB	Alpha Diagnostics	1 mg	EUR 202

Rabbit IgG (Fc) fragment, purified
20009-1-FC	Alpha Diagnostics	0.5 mg	EUR 250

Goat IgG Fab fragment, purified
20011-1-FAB	Alpha Diagnostics	0.5 mg	EUR 202

Goat IgG (Fc) fragment, purified
20011-1-FC	Alpha Diagnostics	0.5 mg	EUR 250

heparin cofactor II precursor fragment [Homo sapiens]
A1144-1	ApexBio	1 mg	EUR 108
Description: heparin cofactor II precursor fragment [Homo sapiens], (C65H99N17O18), a peptide with the sequence H2N-Tyr-Glu-Ile-Thr-Thr-Ile-His-Asn-Leu-Phe-Arg-OH, MW=1406.58.

alpha-1 antitrypsin fragment 235-243 [Homo sapiens]/[Papio hamadryas]/[Cercopithecus aethiops]
A1052-1	ApexBio	1 mg	EUR 108
Description: alpha-1 antitrypsin fragment 235-243 [Homo sapiens]/[Papio hamadryas]/[Cercopithecus aethiops]

HIV-1 Tat Protein Peptide
B1433-1	ApexBio	1 mg	EUR 128
Description: HIV-1 Tat Protein Peptide

Amyloid ?-Peptide (1-42) (human)
B6057-.1	ApexBio	100 ug	EUR 276

Rat Trypsinogen activation peptide ELISA kit
E02T0500-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rat Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Trypsinogen activation peptide ELISA kit
E02T0500-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rat Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rat Trypsinogen activation peptide ELISA kit
E02T0500-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rat Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Trypsinogen activation peptide ELISA kit
E04T0500-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Trypsinogen activation peptide ELISA kit
E04T0500-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Rabbit Trypsinogen activation peptide ELISA kit
E04T0500-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Rabbit Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Trypsinogen activation peptide ELISA kit
E03T0500-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Mouse Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Trypsinogen activation peptide ELISA kit
E03T0500-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Mouse Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Mouse Trypsinogen activation peptide ELISA kit
E03T0500-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Mouse Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Trypsinogen activation peptide ELISA kit
E01T0500-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Human Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Trypsinogen activation peptide ELISA kit
E01T0500-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Human Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Trypsinogen activation peptide ELISA kit
E01T0500-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Human Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Trypsinogen activation peptide ELISA kit
E08T0500-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Canine Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Trypsinogen activation peptide ELISA kit
E08T0500-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Canine Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Dog Trypsinogen activation peptide ELISA kit
E08T0500-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Canine Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Trypsinogen activation peptide ELISA kit
E07T0500-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Porcine Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Trypsinogen activation peptide ELISA kit
E07T0500-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Porcine Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Pig Trypsinogen activation peptide ELISA kit
E07T0500-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Porcine Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Trypsinogen activation peptide ELISA kit
E09T0500-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Monkey Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Trypsinogen activation peptide ELISA kit
E09T0500-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Monkey Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Monkey Trypsinogen activation peptide ELISA kit
E09T0500-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Monkey Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human trypsinogen activation peptide ELISA Kit
ELA-E0634h	Lifescience Market	96 Tests	EUR 824

Rat trypsinogen activation peptide ELISA Kit
ELA-E0634r	Lifescience Market	96 Tests	EUR 886

Goat Trypsinogen activation peptide ELISA kit
E06T0500-192T	B-Gene	192 tests	EUR 1270
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Goat Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Trypsinogen activation peptide ELISA kit
E06T0500-48	B-Gene	1 plate of 48 wells	EUR 520
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Goat Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Goat Trypsinogen activation peptide ELISA kit
E06T0500-96	B-Gene	1 plate of 96 wells	EUR 685
Kit contents: 1. MICROTITER PLATE * 1 2. ENZYME CONJUGATE1 vial 3. STANDARD A1 vial 4. STANDARD B1 vial 5. STANDARD C1 vial 6. STANDARD D1 vial 7. STANDARD E1 vial 8. STANDARD F1 vial 9. SUBSTRATE A1 vial 10. SUBSTRATE B*1 vial 11. STOP SOLUT Show more
Description: A competitive ELISA for quantitative measurement of Goat Trypsinogen activation peptide in samples from blood, plasma, serum, cell culture supernatant and other biological fluids. This is a high quality ELISA kit developped for optimal performance with samples from the particular species.

Human Trypsinogen Activation Peptide (TAP) Protein
20-abx655357	Abbexa	EUR 578.00 EUR 258.00 EUR 1720.00 EUR 690.00 EUR 425.00	100 ug 10 ug 1 mg 200 ug 50 ug
Shipped within 5-15 working days.

BSA Conjugated Trypsinogen Activation Peptide (TAP)
4-CPA634Hu11	Cloud-Clone	EUR 173.47 EUR 149.00 EUR 375.52 EUR 191.84 EUR 283.68 EUR 179.00 EUR 788.80	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: Inquire Buffer composition: PBS, pH 7.4. Form: Freeze-dried powder Predicted Molecular Mass (KD): Inquire Isoelectric Point: Inquire
Description: Recombinant Human Trypsinogen Activation Peptide expressed in: Protein conjugation

OVA Conjugated Trypsinogen Activation Peptide (TAP)
4-CPA634Hu21	Cloud-Clone	EUR 173.47 EUR 149.00 EUR 375.52 EUR 191.84 EUR 283.68 EUR 179.00 EUR 788.80	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: Inquire Buffer composition: PBS, pH 7.4. Form: Freeze-dried powder Predicted Molecular Mass (KD): Inquire Isoelectric Point: Inquire
Description: Recombinant Human Trypsinogen Activation Peptide expressed in: Protein conjugation

BSA Conjugated Trypsinogen Activation Peptide (TAP)
4-CPA634Mu11	Cloud-Clone	EUR 173.47 EUR 149.00 EUR 375.52 EUR 191.84 EUR 283.68 EUR 179.00 EUR 788.80	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: Inquire Buffer composition: PBS, pH 7.4. Form: Freeze-dried powder Predicted Molecular Mass (KD): Inquire Isoelectric Point: Inquire
Description: Recombinant Mouse Trypsinogen Activation Peptide expressed in: Protein conjugation

OVA Conjugated Trypsinogen Activation Peptide (TAP)
4-CPA634Mu21	Cloud-Clone	EUR 173.47 EUR 149.00 EUR 375.52 EUR 191.84 EUR 283.68 EUR 179.00 EUR 788.80	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: Inquire Buffer composition: PBS, pH 7.4. Form: Freeze-dried powder Predicted Molecular Mass (KD): Inquire Isoelectric Point: Inquire
Description: Recombinant Mouse Trypsinogen Activation Peptide expressed in: Protein conjugation

BSA Conjugated Trypsinogen Activation Peptide (TAP)
4-CPA634Ra11	Cloud-Clone	EUR 173.47 EUR 149.00 EUR 375.52 EUR 191.84 EUR 283.68 EUR 179.00 EUR 788.80	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: Inquire Buffer composition: PBS, pH 7.4. Form: Freeze-dried powder Predicted Molecular Mass (KD): Inquire Isoelectric Point: Inquire
Description: Recombinant Rat Trypsinogen Activation Peptide expressed in: Protein conjugation

OVA Conjugated Trypsinogen Activation Peptide (TAP)
4-CPA634Ra21	Cloud-Clone	EUR 173.47 EUR 149.00 EUR 375.52 EUR 191.84 EUR 283.68 EUR 179.00 EUR 788.80	100 ug 10ug 1 mg 200 ug 500 ug 50ug 5 mg
Uniprot ID: Inquire Buffer composition: PBS, pH 7.4. Form: Freeze-dried powder Predicted Molecular Mass (KD): Inquire Isoelectric Point: Inquire
Description: Recombinant Rat Trypsinogen Activation Peptide expressed in: Protein conjugation

Trypsinogen Activation Peptide (TAP) Polyclonal Antibody (Human), APC
4-PAA634Hu01-APC	Cloud-Clone	EUR 323.00 EUR 2969.00 EUR 836.00 EUR 409.00 EUR 210.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: OVA conjugated Trypsinogen Activation Peptide(TAP) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Trypsinogen Activation Peptide (TAP). This antibody is labeled with APC.

Trypsinogen Activation Peptide (TAP) Polyclonal Antibody (Human), Biotinylated
4-PAA634Hu01-Biotin	Cloud-Clone	EUR 295.00 EUR 2235.00 EUR 671.00 EUR 358.00 EUR 212.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: OVA conjugated Trypsinogen Activation Peptide(TAP) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Trypsinogen Activation Peptide (TAP). This antibody is labeled with Biotin.

Trypsinogen Activation Peptide (TAP) Polyclonal Antibody (Human), Cy3
4-PAA634Hu01-Cy3	Cloud-Clone	EUR 390.00 EUR 3917.00 EUR 1073.00 EUR 504.00 EUR 239.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: OVA conjugated Trypsinogen Activation Peptide(TAP) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Trypsinogen Activation Peptide (TAP). This antibody is labeled with Cy3.

Trypsinogen Activation Peptide (TAP) Polyclonal Antibody (Human), FITC
4-PAA634Hu01-FITC	Cloud-Clone	EUR 279.00 EUR 2395.00 EUR 688.00 EUR 347.00 EUR 188.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: OVA conjugated Trypsinogen Activation Peptide(TAP) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Trypsinogen Activation Peptide (TAP). This antibody is labeled with FITC.

Trypsinogen Activation Peptide (TAP) Polyclonal Antibody (Human), HRP
4-PAA634Hu01-HRP	Cloud-Clone	EUR 297.00 EUR 2589.00 EUR 741.00 EUR 371.00 EUR 199.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: OVA conjugated Trypsinogen Activation Peptide(TAP) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Trypsinogen Activation Peptide (TAP). This antibody is labeled with HRP.

Trypsinogen Activation Peptide (TAP) Polyclonal Antibody (Human), PE
4-PAA634Hu01-PE	Cloud-Clone	EUR 279.00 EUR 2395.00 EUR 688.00 EUR 347.00 EUR 188.00	100ul 10ml 1ml 200ul 20ul
Sequence of the immunogen: OVA conjugated Trypsinogen Activation Peptide(TAP) Buffer composition: PBS, pH7.4, containing 0.02% NaN3, 50% glycerol.
Description: A Rabbit polyclonal antibody against Human Trypsinogen Activation Peptide (TAP). This antibody is labeled with PE.

immunoglobulin light chain variable region fragment [Homo sapiens]
A1071-1	ApexBio	1 mg	EUR 108
Description: Immunoglobulin light chain variable region fragment [Homo sapiens] is a fragment (Phe-Thr-Leu-Lys-Ile-Ser-Arg) on the variable region of the human immunoglobulin light chain.Immunoglobulins (Ig) are the antigen recognition molecules of B cells.

Immunoglobulin M heavy chain (IGHM) fragment [Homo sapiens]
A1073-1	ApexBio	1 mg	EUR 108
Description: Immunoglobulin M heavy chain (IGHM) fragment [Homo sapiens] is a fragment (Gly-Val-Ala-Leu-His-Arg-Pro-Asp-Val-Tyr-Leu-Leu-Pro-Pro-Ala-Arg) on the the human immunoglobulin micro heavy chain.

signal transducer and activator of transcription 6 fragment
A1090-1	ApexBio	1 mg	EUR 108
Description: Signal transducer and activator of transcription 6 fragment, (C54H81N13O15), a peptide with the sequence H2N-Ser-Tyr-Trp-Ser-Asp-Arg-Leu-Ile-Ile-OH, MW= 1152.3. STAT6 is a member of the STAT family of transcription factors(1).

heparin cofactor II precursor (SERPIND1) fragment [Homo sapiens]
A1143-1	ApexBio	1 mg	EUR 108
Description: heparin cofactor II precursor (SERPIND1) fragment [Homo sapiens], (C95H137N23O22), a peptide with the sequence H2N-Phe-Thr-Val-Asp-Arg- Pro-Phe-Leu-Phe-Leu-Ile-Tyr-Glu-His-Arg-OH, MW=1953.25.

Lytic Peptide, Shiva ? 1
SP-88327-1	Alpha Diagnostics	1 mg	EUR 347

This on-line, cross-sectional examine aimed to find out the affect of COVID-19 on perceived stress ranges of medical students, examine doable contributing and assuaging elements, and produce suggestions for medical faculties to implement throughout future healthcare emergencies. The majority (54.5%) of respondents reported ranges of stress starting from reasonable to excessive.

Les controles de qPCR pour le Covid

Envoi de Paris

NATtrol Influenza/RSV Negative Control (6 x 0.5 mL) NATCXVA9-6C
NATtrol Influenza Verification Panel (18 x 0.5 mL) NATFVP(XP)-C
NATtrol Influenza A/B Positive Control (6 x 0.5 mL) NATFLUA/B-6MC
NATtrol Influenza Negative Control (6 x 0.5 mL) NATCXVA9-6MC
NATtrol Influenza A H1N1 Positive Control (6 x 0.5 mL) NATFLUAH1N1-6MC
NATtrol Flu/RSV/SARS-CoV-2 Positive Control (6 x 0.5mL) NATFRC-6C
NATtrol Flu/RSV/SARS-CoV-2 Negative Control (6 x 0.5mL) NATCV9-6C

THE EFFECTS OF PARTICIPATING IN A RESEARCH TEAM DURING THE COVID-19 PANDEMIC ON THE EDUCATIONAL ROUTINE AND MENTAL HEALTH OF MEDICAL STUDENTS: A STUDY PROTOCOL FOR A WEB BASED SURVEY

The COVID-19 pandemic has supplied social isolation with a possible adverse influence on the tutorial routine, together with the suspension of face-to-face appointments, and psychological well being of medical college students. The Mario Pinotti II examine (MPII) is a 24-week observational examine with scheduled phone calls each 2 weeks to confirm the incidence of the COVID-19 in rheumatic sufferers on hydroxychloroquine chronically (from 29th, March, 2020 to 30th, September, 2020). The results of voluntary participation in a analysis mission, which foresees interplay by phone contact with sufferers, professors, rheumatologists, and colleagues on the each day life and psychological well being of medical college students requires analysis.

Considering that medical college students are professionals in coaching with a excessive degree of accountability to deal with emotional and bodily features associated to a number of ailments, this examine has the intention of evaluating the influence of the COVID-19 pandemic and participation within the MPII examine, on the tutorial routine and psychological well being of medical college students. A web-based survey was carried out to carry out a cross-sectional comparative evaluation between medical college students taking part within the MPII examine and different their colleagues who should not concerned on this analysis mission, matched to intercourse, age and medical faculty.

The net questionnaire was developed by a panel composed of graduate medical college students, rheumatologists, medical faculty professors, and a psychology professor and it included particulars on demographic and life habits information, in addition to analysis of individuals’ impression concerning the MPII examine and the influence of the COVID-19 pandemic on their academic routine and medical coaching. In addition, the depressive, nervousness, and stress domains have been evaluated utilizing the DASS-21 (Depression, Anxiety and Stress Scale), Brazilian model, and, currently, the scores have been grouped as low, average and excessive threat for psychological misery. This mission was authorised by the Federal University of São Paulo Ethics Committee (CAAE: 34034620.0.0000.5505).

Data assortment was utilized for each medical scholar teams from July 20th to August 31st, 2020. Data extraction was accomplished in September, 2020. Analysis is ongoing. The authors count on the outcomes to be printed within the first semester of 2021. This examine will convey gentle into the consequences of taking part in a analysis mission on depressive, nervousness, and stress domains through the use of the DASS-21 (Depression, Anxiety and Stress Scale) in giant sampling of Brazilian undergraduate medical college students and the analysis of the influence of the COVID-19 pandemic on college students academic routine and medical coaching.

Medical Students on the Virtual Front Line: A Literature Review Elective to Provide COVID-19 Clinical Teams With Essential Information

At the Hackensack Meridian School of Medicine (HMSOM) in New Jersey, medical actions for college students have been suspended on March 15, 2020, because of the COVID-19 pandemic. Clinical groups at Hackensack Meridian Health (HMH) wanted sources for figuring out and assimilating the medical literature concerning COVID-19, which was increasing and evolving each day. HMH leaders reached out to HMSOM leaders for help. The HMSOM management and college shortly organized a literature assessment elective.

Eight second-year medical college students participated in a literature assessment elective course to analysis and synthesize the COVID-19 medical literature to supply synopses of finest practices for varied medical groups. By March 23, college students have been looking the literature and writing reviews independently, mentored by a senior dean (an infectious ailments specialist) and supported by the affiliate dean of libraries and library crew. The library crew up to date and categorized scholar reviews each day on a web site devoted to the elective.

During the 6-week elective, eight college students produced 70 reviews synthesizing the rising COVID-19 literature to assist reply practitioners’ medical questions in actual time. One scholar report was posted on the American Academy of Ophthalmology web site. All 70 have been printed on-line in Elsevier’s well being training college hub. On course evaluations, college students expressed remorse about not being immediately concerned in affected person care, however articulated their gratitude to have the ability to contribute to the medical groups.

In June 2020, the scholars returned to their medical clerkships as COVID-19 medical volumes declined and PPE turned extra accessible. Students continued to be accessible to the medical groups to help with COVID-19 questions. This literature assessment elective can function a mannequin for different medical colleges to make use of to deploy college students to assist synthesize the evolving literature on COVID-19 or different quickly rising analysis matters.

Medical Students as Essential Frontline Researchers During the COVID-19 Pandemic

As the coronavirus illness 2019 (COVID-19) pandemic hit the United States in March 2020, there was widespread disruption of medical medical training: Hospital clerkships have been suspended nationwide, and college students have been moved out of the hospital and continued their research remotely by digital studying programs. Frustrated by not with the ability to immediately take care of sufferers, medical college students throughout the nation fashioned numerous volunteer initiatives to assist frontline clinicians. In this text, the authors describe the important function of medical college students at Weill Cornell Medicine in shortly designing and constructing a big registry of COVID-19 sufferers who introduced at 3 New York City hospitals.

The Cornell COVID-19 registry, which comprises granular medical info on greater than 4,000 sufferers, knowledgeable hospital operations and guided medical administration in the course of the first wave of the pandemic. One month after its creation, the registry led to the primary printed description of the medical traits of a U.S.-based cohort of hospitalized COVID-19 sufferers. Using their expertise as a mannequin, the authors suggest that college students who can’t take part of their medical clerkships due to the pandemic can increase their conventional medical training by contributing to COVID-19 analysis.

DISP2 siRNA
20-abx914190	Abbexa	EUR 551.00 EUR 732.00	15 nmol 30 nmol
Shipped within 5-10 working days.

DISP2 siRNA
20-abx914191	Abbexa	EUR 551.00 EUR 732.00	15 nmol 30 nmol
Shipped within 5-10 working days.

Polyclonal Disp2 Antibody
APR06510G	Leading Biology	0.1 mg	EUR 659
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human Disp2 . This antibody is tested and proven to work in the following applications:

Polyclonal DISP2 Antibody
APR06514G	Leading Biology	0.1 mg	EUR 659
Description: A polyclonal antibody raised in Rabbit that recognizes and binds to Human DISP2 . This antibody is tested and proven to work in the following applications:

DISP2 ELISA KIT\|Human
EF004867	Lifescience Market	96 Tests	EUR 689

Mouse DISP2 shRNA Plasmid
20-abx980854	Abbexa	EUR 801.00 EUR 1121.00	150 µg 300 µg
Shipped within 15-20 working days.

Human DISP2 shRNA Plasmid
20-abx963820	Abbexa	EUR 801.00 EUR 1121.00	150 µg 300 µg
Shipped within 15-20 working days.

Disp2 ORF Vector (Rat) (pORF)
ORF066035	ABM	1.0 ug DNA	EUR 2080

DISP2 ORF Vector (Human) (pORF)
ORF018359	ABM	1.0 ug DNA	EUR 405

Disp2 ORF Vector (Mouse) (pORF)
ORF043041	ABM	1.0 ug DNA	EUR 1572

DISP2 sgRNA CRISPR Lentivector set (Human)
K0604801	ABM	3 x 1.0 ug	EUR 339

Disp2 sgRNA CRISPR Lentivector set (Rat)
K6641301	ABM	3 x 1.0 ug	EUR 339

Disp2 sgRNA CRISPR Lentivector set (Mouse)
K3612501	ABM	3 x 1.0 ug	EUR 339

Canine C-Peptide ELISA Kit
DLR-C-Peptide-c-48T	DL Develop	48T	EUR 527
Should the Canine C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit
DLR-C-Peptide-c-96T	DL Develop	96T	EUR 688
Should the Canine C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Canine C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit
DLR-C-Peptide-Hu-48T	DL Develop	48T	EUR 398
Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Human C-Peptide ELISA Kit
DLR-C-Peptide-Hu-96T	DL Develop	96T	EUR 511
Should the Human C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Human C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit
DLR-C-Peptide-Mu-48T	DL Develop	48T	EUR 450
Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Mouse C-Peptide ELISA Kit
DLR-C-Peptide-Mu-96T	DL Develop	96T	EUR 582
Should the Mouse C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Mouse C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit
DLR-C-Peptide-Ra-48T	DL Develop	48T	EUR 467
Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Rat C-Peptide ELISA Kit
DLR-C-Peptide-Ra-96T	DL Develop	96T	EUR 605
Should the Rat C-Peptide ELISA Kit is proven to show malperformance, you will receive a refund or a free replacement.
Description: A competitive inhibition quantitative ELISA assay kit for detection of Rat C-Peptide in samples from serum, plasma, tissue homogenates, cell lysates, cell culture supernates or other biological fluids.

Canine C-Peptide ELISA Kit
RDR-C-Peptide-c-48Tests	Reddot Biotech	48 Tests	EUR 557

Canine C-Peptide ELISA Kit
RDR-C-Peptide-c-96Tests	Reddot Biotech	96 Tests	EUR 774

Human C-Peptide ELISA Kit
RDR-C-Peptide-Hu-48Tests	Reddot Biotech	48 Tests	EUR 404

Human C-Peptide ELISA Kit
RDR-C-Peptide-Hu-96Tests	Reddot Biotech	96 Tests	EUR 556

Mouse C-Peptide ELISA Kit
RDR-C-Peptide-Mu-48Tests	Reddot Biotech	48 Tests	EUR 465

Mouse C-Peptide ELISA Kit
RDR-C-Peptide-Mu-96Tests	Reddot Biotech	96 Tests	EUR 643

Rat C-Peptide ELISA Kit
RDR-C-Peptide-Ra-48Tests	Reddot Biotech	48 Tests	EUR 486

Rat C-Peptide ELISA Kit
RDR-C-Peptide-Ra-96Tests	Reddot Biotech	96 Tests	EUR 672

Canine C-Peptide ELISA Kit
RD-C-Peptide-c-48Tests	Reddot Biotech	48 Tests	EUR 533

Canine C-Peptide ELISA Kit
RD-C-Peptide-c-96Tests	Reddot Biotech	96 Tests	EUR 740

Human C-Peptide ELISA Kit
RD-C-Peptide-Hu-48Tests	Reddot Biotech	48 Tests	EUR 387

Human C-Peptide ELISA Kit
RD-C-Peptide-Hu-96Tests	Reddot Biotech	96 Tests	EUR 532

Mouse C-Peptide ELISA Kit
RD-C-Peptide-Mu-48Tests	Reddot Biotech	48 Tests	EUR 446

Mouse C-Peptide ELISA Kit
RD-C-Peptide-Mu-96Tests	Reddot Biotech	96 Tests	EUR 615

Rat C-Peptide ELISA Kit
RD-C-Peptide-Ra-48Tests	Reddot Biotech	48 Tests	EUR 465

Rat C-Peptide ELISA Kit
RD-C-Peptide-Ra-96Tests	Reddot Biotech	96 Tests	EUR 643

DISP2 sgRNA CRISPR Lentivector (Human) (Target 1)
K0604802	ABM	1.0 ug DNA	EUR 154

DISP2 sgRNA CRISPR Lentivector (Human) (Target 2)
K0604803	ABM	1.0 ug DNA	EUR 154

DISP2 sgRNA CRISPR Lentivector (Human) (Target 3)
K0604804	ABM	1.0 ug DNA	EUR 154

Disp2 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6641302	ABM	1.0 ug DNA	EUR 154

Disp2 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6641303	ABM	1.0 ug DNA	EUR 154

Disp2 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6641304	ABM	1.0 ug DNA	EUR 154

Disp2 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K3612502	ABM	1.0 ug DNA	EUR 154

Disp2 sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3612503	ABM	1.0 ug DNA	EUR 154

Disp2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3612504	ABM	1.0 ug DNA	EUR 154

DISP2 Protein Vector (Mouse) (pPB-C-His)
PV172162	ABM	500 ng	EUR 2302

DISP2 Protein Vector (Mouse) (pPB-N-His)
PV172163	ABM	500 ng	EUR 2302

DISP2 Protein Vector (Mouse) (pPM-C-HA)
PV172164	ABM	500 ng	EUR 2302

DISP2 Protein Vector (Mouse) (pPM-C-His)
PV172165	ABM	500 ng	EUR 2302

DISP2 Protein Vector (Rat) (pPB-C-His)
PV264138	ABM	500 ng	EUR 2303

DISP2 Protein Vector (Rat) (pPB-N-His)
PV264139	ABM	500 ng	EUR 2303

DISP2 Protein Vector (Rat) (pPM-C-HA)
PV264140	ABM	500 ng	EUR 2303

DISP2 Protein Vector (Rat) (pPM-C-His)
PV264141	ABM	500 ng	EUR 2303

DISP2 Protein Vector (Human) (pPB-C-His)
PV073433	ABM	500 ng	Ask for price

DISP2 Protein Vector (Human) (pPB-N-His)
PV073434	ABM	500 ng	Ask for price

DISP2 Protein Vector (Human) (pPM-C-HA)
PV073435	ABM	500 ng	Ask for price

DISP2 Protein Vector (Human) (pPM-C-His)
PV073436	ABM	500 ng	Ask for price

Disp2 3'UTR GFP Stable Cell Line
TU155166	ABM	1.0 ml	Ask for price

Disp2 3'UTR Luciferase Stable Cell Line
TU105166	ABM	1.0 ml	Ask for price

Disp2 3'UTR Luciferase Stable Cell Line
TU203430	ABM	1.0 ml	Ask for price

Disp2 3'UTR GFP Stable Cell Line
TU253430	ABM	1.0 ml	Ask for price

DISP2 3'UTR GFP Stable Cell Line
TU056038	ABM	1.0 ml	EUR 1394

DISP2 3'UTR Luciferase Stable Cell Line
TU006038	ABM	1.0 ml	EUR 1394

Human Protein dispatched homolog 2 (DISP2) ELISA Kit
abx384802-96tests	Abbexa	96 tests	EUR 911
Shipped within 5-12 working days.

Mouse Protein dispatched homolog 2 (DISP2) ELISA Kit
abx389082-96tests	Abbexa	96 tests	EUR 911
Shipped within 5-12 working days.

Human Protein dispatched homolog 2, DISP2 ELISA KIT
ELI-32162h	Lifescience Market	96 Tests	EUR 824

Mouse Protein dispatched homolog 2, Disp2 ELISA KIT
ELI-46875m	Lifescience Market	96 Tests	EUR 865

DISP2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV621787	ABM	1.0 ug DNA	EUR 2157

DISP2 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV621791	ABM	1.0 ug DNA	EUR 2157

DISP2 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV621792	ABM	1.0 ug DNA	EUR 2157

ELISA kit for Mouse Protein dispatched homolog 2 (DISP2)
KTE71270-48T	Abbkine	48T	EUR 332
The pattern of cellular proliferation and differentiation that leads to normal development of embryonic structures often depends upon the localized production of secreted protein signals. Cells surrounding the source of a particular signal respond in Show more
Description: Quantitative sandwich ELISA for measuring Mouse Protein dispatched homolog 2 (DISP2) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Mouse Protein dispatched homolog 2 (DISP2)
KTE71270-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2115
The pattern of cellular proliferation and differentiation that leads to normal development of embryonic structures often depends upon the localized production of secreted protein signals. Cells surrounding the source of a particular signal respond in Show more
Description: Quantitative sandwich ELISA for measuring Mouse Protein dispatched homolog 2 (DISP2) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Mouse Protein dispatched homolog 2 (DISP2)
KTE71270-96T	Abbkine	96T	EUR 539
The pattern of cellular proliferation and differentiation that leads to normal development of embryonic structures often depends upon the localized production of secreted protein signals. Cells surrounding the source of a particular signal respond in Show more
Description: Quantitative sandwich ELISA for measuring Mouse Protein dispatched homolog 2 (DISP2) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Protein dispatched homolog 2 (DISP2)
KTE62044-48T	Abbkine	48T	EUR 332
The pattern of cellular proliferation and differentiation that leads to normal development of embryonic structures often depends upon the localized production of secreted protein signals. Cells surrounding the source of a particular signal respond in Show more
Description: Quantitative sandwich ELISA for measuring Human Protein dispatched homolog 2 (DISP2) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Protein dispatched homolog 2 (DISP2)
KTE62044-5platesof96wells	Abbkine	5 plates of 96 wells	EUR 2115
The pattern of cellular proliferation and differentiation that leads to normal development of embryonic structures often depends upon the localized production of secreted protein signals. Cells surrounding the source of a particular signal respond in Show more
Description: Quantitative sandwich ELISA for measuring Human Protein dispatched homolog 2 (DISP2) in samples from cell culture supernatants, serum, whole blood, plasma and other biological fluids.

ELISA kit for Human Protein dispatched homolog 2 (DISP2)
KTE62044-96T	Abbkine	96T	EUR 539
The pattern of cellular proliferation and differentiation that leads to normal development of embryonic structures often depends upon the localized production of secreted protein signals. Cells surrounding the source of a particular signal respond in Show more

Impact of Service User Video Presentations on Explicit and Implicit Stigma towards Mental Illness amongst Medical Students in Nepal: A Randomized Controlled Trial

Specific mindfulness traits shield towards destructive results of trait anxiousness on medical pupil wellbeing throughout high-pressure durations

Donkey Anti-Sheep IgG (H&L), 10MG

Anti-Inflammatory Peptide 1

Anti-Inflammatory Peptide 1

Anti-Inflammatory Peptide 1

Anti-Inflammatory Peptide 1

Anti-Inflammatory Peptide 1

Anti-Inflammatory Peptide 1

Anti-Inflammatory Peptide 1

Recombinant other protein 1, Untagged, E.coli-10mg

Recombinant other protein 1, Untagged, E.coli-10mg

Recombinant other Alarelin Protein, Untagged, -10mg

Anti-Inflammatory Peptide 2

Anti-Inflammatory Peptide 3

Anti-Inflammatory Peptide 3

Anti-Inflammatory Peptide 2

Anti-Inflammatory Peptide 2

Anti-Inflammatory Peptide 2

Recombinant Human GH1/ Growth hormone 1 Protein, Untagged, E.coli-10mg

Recombinant Human EDN3 Protein, Untagged, E.coli-10mg

Recombinant other Exenatide Protein, Untagged, E.coli-10mg

Recombinant E.coli LACTB Protein, Untagged, E.coli-10mg

Recombinant other Lanreotide Protein, Untagged, E.coli-10mg

Recombinant Human LHRH Protein, Untagged, E.coli-10mg

Recombinant Human Leptin Protein, Untagged, E.coli-10mg

Recombinant Mouse Leptin Protein, Untagged, E.coli-10mg

Recombinant Rat Leptin Protein, Untagged, E.coli-10mg

Recombinant Human Insulin Protein, Untagged, E.coli-10mg

Recombinant other Lysostaphin Protein, Untagged, E.coli-10mg

Recombinant Multi Species ACTH Protein, Untagged, -10mg

Recombinant other Atosiban Protein, Untagged, E.coli-10mg

Recombinant other Cetrorelix Protein, Untagged, E.coli-10mg

Recombinant other SPA Protein, His, E.coli-10mg

Recombinant other SST Protein, Untagged, E.coli-10mg

Recombinant Rabbit TNC Protein, Untagged, Rabbit-10mg

Recombinant other Avidin Biotin Protein, Untagged, -10mg

Recombinant Human CTRB1 Protein, Untagged, E.coli-10mg

Polyclonal Goat anti-GST α-form

Recombinant Human Ferritin Protein, Untagged, Native Protein-10mg

Recombinant Bovine Fibronectin Protein, Untagged, Native Protein-10mg

Recombinant Human Fibronectin Protein, Untagged, Native Protein-10mg

Recombinant Human Haptoglobin Protein, Untagged, Native Protein-10mg

Recombinant Human HbA1c Protein, Untagged, Native Protein-10mg

Recombinant Human HDL Protein, Untagged, Native Protein-10mg

Recombinant other HSA Protein, Untagged, Pichia Pastoris-10mg

Recombinant other HSA Recombinant Protein, Untagged, Rice-10mg

Recombinant Human LDL Protein, Untagged, Native Protein-10mg

Recombinant Human LTF Protein, Untagged, Native Protein-10mg

Recombinant Human LTF Holo Protein, Untagged, Rice-10mg

Recombinant Human Myoglobin Protein, Untagged, Native Protein-10mg

Recombinant other Protein-L Protein, Untagged, E.coli-10mg

Recombinant other Lipase A Protein, Untagged, E.coli-10mg

Recombinant Human MG Protein, Untagged, Native Protein-10mg

Recombinant Bovine Trypsin Protein, Untagged, Native Protein-10mg

Recombinant Human UTI Protein, Untagged, Native Protein-10mg

Recombinant Human A2M Protein, Untagged, Native Protein-10mg

Recombinant Human APOB Protein, Untagged, Native Protein-10mg

Recombinant Human B2M Protein, Untagged, Native Protein-10mg

Recombinant Human C1q Protein, Untagged, Native Protein-10mg

Recombinant Human C3c Protein, Untagged, Native Protein-10mg

Recombinant Human C4c Protein, Untagged, Native Protein-10mg

Recombinant Human CKM Protein, Untagged, Native Protein-10mg

Recombinant Human CRP Protein, Untagged, Native Protein-10mg

Recombinant other SPA 33.4kDa Protein, Untagged, E.coli-10mg

Recombinant other SPA Long Protein, Untagged, E.coli-10mg

Recombinant other SPA-Cys Protein, Untagged, E.coli-10mg

Recombinant other Streptavidin Protein, Untagged, Native Protein-10mg

Recombinant Multi Species Trp Protein, Untagged, E.coli-10mg

Recombinant other hCG Protein, Untagged, Native Protein-10mg

Recombinant other HSA Lipid free Protein, Untagged, Rice-10mg

Recombinant other Protein-A/G Protein, His, E.coli-10mg

Recombinant other Protein-G His Protein, His, E.coli-10mg

Recombinant other Protein-L Cys Protein, Untagged, E.coli-10mg

Recombinant Human Collagen-III Protein, Untagged, Pichia Pastoris-10mg

Recombinant other Cys-Protein-G Protein, Untagged, E.coli-10mg

Recombinant other Cys-Protein-L Protein, Untagged, E.coli-10mg

Recombinant other SPA-Cys His Protein, His, E.coli-10mg

Recombinant other SPA-Cys Long Protein, Untagged, E.coli-10mg

Recombinant other Protein Cys-A/G Protein, Untagged, E.coli-10mg